Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349844

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLY antigen name:Large envelope protein host organism:Mus musculus C57BL/10

    Publication: 2425034;

  2. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349956

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  3. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349959

    Description: epitope description:MQWNSTALHQAL antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  4. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349960

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  5. Hybrid hepatitis B virus nucleocapsid bearing an immunodominant region from hepatitis B virus surface antigen.

    ID: 1349968

    Description: epitope description:PGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTC antigen name:Large envelope protein host organism:Mus musculus antibody name:anti-HBc&Delt...

    Publication: 7684473;

  6. Serum anti-GQ1b IgG antibodies recognize surface epitopes on Campylobacter jejuni from patients with Miller Fisher syndrome.

    ID: 1349971

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 7531419;

  7. A monoclonal antibody against a hepatitis B e antigen epitope borne by six amino acids encoded by the precore region.

    ID: 1349992

    Description: epitope description:IDPY antigen name:External core antigen host organism:Mus musculus antibody name:19C1-8

    Publication: 9389411;

  8. A monoclonal antibody against a hepatitis B e antigen epitope borne by six amino acids encoded by the precore region.

    ID: 1350004

    Description: epitope description:RPPNAPIL antigen name:External core antigen host organism:Mus musculus antibody name:C33

    Publication: 9389411;

  9. Localization of the amino terminus of the hepatitis B virus core antigen within the core particle.

    ID: 1350023

    Description: epitope description:MDIDPYKEFGA antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:E1A7

    Publication: 9453141;

  10. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1350038

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston