Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "
  1. Diagnosis and differentiation of HTLV-I and HTLV-II infection by enzyme immunoassays using synthetic peptides.

    ID: 1463958

    Description: epitope description:TSEPTQPPPTSPPLVHDSDLEHVLTPSTSWTTKILKF antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1941526;
  2. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420203

    Description: epitope description:PEKTPLPVSATAMAPSVDPS antigen name:Envelope glycoprotein G host organism:Mus musculus antibody name:F11

    Publication: 10423148;
  3. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420213

    Description: epitope description:RAMAGRCRLLLSIGS host organism:Mus musculus antibody name:F11

    Publication: 10423148;
  4. Identification of an epitope on the recombinant bovine PrP that is able to elicit a prominent immune response in wild-type mice.

    ID: 1420229

    Description: epitope description:DYEDRYYRE antigen name:Major prion protein host organism:Mus musculus antibody name:6H4

    Publication: 17884181;
  5. Identification of type-specific domains within glycoprotein G of herpes simplex virus type 2 (HSV-2) recognized by the majority of patients infected w...

    ID: 1420249

    Description: epitope description:PEHRGGPEEFEGAGDGEPPE antigen name:Envelope glycoprotein G host organism:Homo sapiens antibody name:Human sera

    Publication: 10423148;

Displaying 5 of 1,510,353 results for " "