Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Characterization of intertype specific epitopes on adenovirus hexons.

    ID: 1513329

    Description: epitope description:NQAVDSYDPD antigen name:Hexon protein host organism:Mus musculus BALB/c

    Publication: 9787653;

  2. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1513333

    Description: epitope description:KMKSRKSCGIAVGTTWDADKYAVTPTTSDVAGLEKDPVA host organism:Mus musculus A/J

    Publication: 1694217;

  3. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1513334

    Description: epitope description:KMKSRKSCGIAVGTTWDADKYAVTPTTSDVAGLEKDPVA host organism:Mus musculus A/J

    Publication: 1694217;

  4. Evaluation of mutagenesis for epitope mapping. Structure of an antibody-protein antigen complex.

    ID: 1513458

    Description: epitope description:M1, F2, Q3, Q4, T34, S41, S64, E66, G67, E68, E70, Q71, K72, E75 antigen name:Phosphocarrier protein HPr host organism:Mus musculu...

    Publication: 7684366;

  5. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513483

    Description: epitope description:VDELD antigen name:Basic phospholipase A2 pseudexin B chain host organism:Mus musculus BALB/c antibody name:mAb 2

    Publication: 1718309;

  6. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513486

    Description: epitope description:YGCYCGLGG antigen name:Phospholipase A2, major isoenzyme host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  7. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513487

    Description: epitope description:YGCYCGAGG antigen name:Basic phospholipase A2 notechis 11'2 host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  8. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513491

    Description: epitope description:FPKMSAYDY antigen name:Scutoxin host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  9. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513496

    Description: epitope description:NTKWDIYRY antigen name:Phospholipase A2 crotoxin basic chain CBa2 host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  10. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513499

    Description: epitope description:IDDLD antigen name:Acidic phospholipase A2 homolog taipoxin gamma chain host organism:Mus musculus BALB/c antibody name:Mab 2

    Publication: 1718309;

  11. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513500

    Description: epitope description:YGCYCGKGG antigen name:Basic phospholipase A2 taipoxin alpha chain host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  12. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513501

    Description: epitope description:TPYTSLYTW antigen name:Vipera aspis (aspic viper) protein host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  13. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513506

    Description: epitope description:YGCYCGWGG antigen name:Phospholipase A2 crotoxin basic chain CBa2 host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  14. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513509

    Description: epitope description:YGCYCGRGG antigen name:Acidic phospholipase A2 2 host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  15. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513510

    Description: epitope description:YGCYCGVGG antigen name:Basic phospholipase A2 ammodytoxin B host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  16. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513513

    Description: epitope description:NTKWDIYGY antigen name:Vipera aspis (aspic viper) protein host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  17. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513533

    Description: epitope description:YGCYCGAGG antigen name:Basic phospholipase A2 notechis 11'2 host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  18. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513535

    Description: epitope description:IDDLD antigen name:Acidic phospholipase A2 homolog taipoxin gamma chain host organism:Mus musculus BALB/c antibody name:mAb 2

    Publication: 1718309;

  19. Immunogenicity of poliovirus B and T cell epitopes presented by hybrid porcine parvovirus particles.

    ID: 1513613

    Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7561778;

  20. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1513669

    Description: epitope description:WNIYQNCSKCNN antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  21. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1513671

    Description: epitope description:NIYQNCSKCNNS antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  22. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513705

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  23. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513706

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  24. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513707

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  25. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513710

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  26. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513711

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  27. Synthesis of bluetongue virus chimeric VP3 molecules and their interactions with VP7 protein to assemble into virus core-like particles.

    ID: 1513720

    Description: epitope description:ATGWQTIDGKKYYFNTNTAEAATGWQTIDGKKYYFNTNTAIAST antigen name:Toxin A host organism:Mus musculus BALB/c antibody name:Anti-toxin A

    Publication: 8553561;

  28. Topology of the major capsid protein P3 of bacteriophage PRD1: analysis using monoclonal antibodies and C-terminally truncated proteins.

    ID: 1513722

    Description: epitope description:TGELTMYYWV antigen name:Major capsid protein P3 host organism:Mus musculus BALB/c antibody name:3N81, 3R2

    Publication: 7504366;

  29. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513736

    Description: epitope description:FGKLRVGRLNSV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  30. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513737

    Description: epitope description:DVTLYGTIKAGV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  31. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513738

    Description: epitope description:TIKAGVETSRSV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  32. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513743

    Description: epitope description:FKGQEDLGNGLK antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  33. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513745

    Description: epitope description:AIWQVEQKASIA antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  34. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513747

    Description: epitope description:GTDSGWGNRQSF antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  35. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513749

    Description: epitope description:IGLKGGFGKLRV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  36. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513763

    Description: epitope description:FFVQYGGAYKRH antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  37. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513771

    Description: epitope description:AKLTDASNSHNS antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  38. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513779

    Description: epitope description:EYDQVVVGAEYD antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  39. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513796

    Description: epitope description:IGLKGGFGKLRV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  40. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513798

    Description: epitope description:INPWDSKSDYLG antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  41. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513803

    Description: epitope description:SGSVQYALNDNA antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  42. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513805

    Description: epitope description:GRHNSESYHAGF antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  43. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513809

    Description: epitope description:GAYKRHHQVQEG antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  44. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513810

    Description: epitope description:LNIEKYQIHRLV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  45. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513819

    Description: epitope description:VGAEYDFSKRTS antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  46. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513822

    Description: epitope description:WLQEGKGENKFV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  47. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513833

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  48. Analysis of the putative E1 envelope and NS4a epitope regions of HCV type 3.

    ID: 1513910

    Description: epitope description:SQAAPYIEQAQVIAHQFKEK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7683463;

  49. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1513912

    Description: epitope description:DVTLYGTIKAGV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  50. Analysis of the putative E1 envelope and NS4a epitope regions of HCV type 3.

    ID: 1513913

    Description: epitope description:LSGKPAIIPDREVLYREFDE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7683463;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston