Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347322

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P8

    Publication: 16272297;

  2. A surrogate hepatitis B virus antigenic epitope represented by a synthetic peptide and an internal image antiidiotype antibody.

    ID: 1347331

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 2425029;

  3. A surrogate hepatitis B virus antigenic epitope represented by a synthetic peptide and an internal image antiidiotype antibody.

    ID: 1347335

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Capra hircus

    Publication: 2425029;

  4. A surrogate hepatitis B virus antigenic epitope represented by a synthetic peptide and an internal image antiidiotype antibody.

    ID: 1347337

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Cavia porcellus

    Publication: 2425029;

  5. The cellular location of a foreign B cell epitope expressed by recombinant bacteria determines its T cell-independent or T cell-dependent characterist...

    ID: 1347356

    Description: epitope description:QDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 1719080;

  6. Lipooligosaccharidic antigens from Mycobacterium kansasii and Mycobacterium gastri.

    ID: 1352136

    Description: epitope description:3,6-dideoxy-4-C-(1,3-dimethoxy-4,5,6,7-tetrahydroxyheptyl)-alpha-D-xylo-hexp-(1->3)-beta-L-Xylp antigen name:lipooligosaccharide h...

    Publication: 7496145;

  7. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352189

    Description: epitope description:IYEATQAASKVGGEASAPGGSNSTD antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  8. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352190

    Description: epitope description:AMEKLGQDSQALGQAIYEATQAASK antigen name:Chaperone protein DnaK host organism:Mus musculus C57BL/6

    Publication: 7678097;

  9. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352191

    Description: epitope description:AMEKLGQDSQALGQAIYEATQAASK antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  10. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352192

    Description: epitope description:AMEKLGQDSQALGQAIYEATQAASK antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston