Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465012

    Description: epitope description:EVDGDVKLSSNLVIL antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  2. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465013

    Description: epitope description:SLSTNLDVTNSIEHQ antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  3. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465015

    Description: epitope description:DLVKFISDKIKFLNP antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  4. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465019

    Description: epitope description:LCENPEWAPLKDNRI antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  5. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465020

    Description: epitope description:LKIKIASGFGPLITH antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  6. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465021

    Description: epitope description:PLITHGSGMDLYKSN antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  7. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465030

    Description: epitope description:LSLLDLYLGRGYNVS antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  8. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465040

    Description: epitope description:LSVDLSLTVELKIKI antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  9. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465044

    Description: epitope description:DCHAPTYLPAEVDGD antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  10. Identification of antigenic regions of the Erns protein for pig antibodies elicited during classical swine fever virus infection.

    ID: 1465048

    Description: epitope description:ECAVTCRYDKDADVNVVTQARNRPTTLTGCKKGKNFS antigen name:Genome polyprotein host organism:Sus scrofa antibody name:CSFV antisera

    Publication: 15671490;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston