Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347259

    Description: epitope description:MLGSAMSRPMIHFGNDWEDRYYRENMYRYP antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P8

    Publication: 16272297;

  2. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347270

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P9

    Publication: 16272297;

  3. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347271

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P9

    Publication: 16272297;

  4. Synthetic peptide antigens of tetanus toxin.

    ID: 1347273

    Description: epitope description:GLVGTHNGQIGNDPNRDILIASNWYFNHLKDKILGCDWYFVPTDEGWTND antigen name:Tetanus toxin host organism:Mus musculus BALB/c

    Publication: 7935502;

  5. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347275

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P9

    Publication: 16272297;

  6. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347276

    Description: epitope description:NQVYYRPVDQYSNQNNFVHDCVNITIKQHT antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P9

    Publication: 16272297;

  7. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347278

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P8

    Publication: 16272297;

  8. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347285

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P8

    Publication: 16272297;

  9. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347305

    Description: epitope description:YPNQVYYRPVDQYSN antigen name:Major prion protein host organism:Mus musculus C57BL/6 antibody name:wt anti-P8

    Publication: 16272297;

  10. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347308

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P8

    Publication: 16272297;

  11. The murine B cell repertoire is severely selected against endogenous cellular prion protein.

    ID: 1347322

    Description: epitope description:DWEDRYYRENMYRYPNQVYYRPVDQYSNQN antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:anti-P8

    Publication: 16272297;

  12. A surrogate hepatitis B virus antigenic epitope represented by a synthetic peptide and an internal image antiidiotype antibody.

    ID: 1347331

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 2425029;

  13. A surrogate hepatitis B virus antigenic epitope represented by a synthetic peptide and an internal image antiidiotype antibody.

    ID: 1347335

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Capra hircus

    Publication: 2425029;

  14. A surrogate hepatitis B virus antigenic epitope represented by a synthetic peptide and an internal image antiidiotype antibody.

    ID: 1347337

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Cavia porcellus

    Publication: 2425029;

  15. The cellular location of a foreign B cell epitope expressed by recombinant bacteria determines its T cell-independent or T cell-dependent characterist...

    ID: 1347356

    Description: epitope description:QDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 1719080;

  16. Lipooligosaccharidic antigens from Mycobacterium kansasii and Mycobacterium gastri.

    ID: 1352136

    Description: epitope description:3,6-dideoxy-4-C-(1,3-dimethoxy-4,5,6,7-tetrahydroxyheptyl)-alpha-D-xylo-hexp-(1->3)-beta-L-Xylp antigen name:lipooligosaccharide h...

    Publication: 7496145;

  17. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352189

    Description: epitope description:IYEATQAASKVGGEASAPGGSNSTD antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  18. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352190

    Description: epitope description:AMEKLGQDSQALGQAIYEATQAASK antigen name:Chaperone protein DnaK host organism:Mus musculus C57BL/6

    Publication: 7678097;

  19. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352191

    Description: epitope description:AMEKLGQDSQALGQAIYEATQAASK antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  20. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352192

    Description: epitope description:AMEKLGQDSQALGQAIYEATQAASK antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  21. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352200

    Description: epitope description:VPEDTLNKVEAAVAEAKTALGGTDI antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  22. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352201

    Description: epitope description:VPEDTLNKVEAAVAEAKTALGGTDI antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  23. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352205

    Description: epitope description:EKFVKEQRETENGSRVPEDTLNKVE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  24. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352206

    Description: epitope description:EKFVKEQRETENGSRVPEDTLNKVE antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  25. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352209

    Description: epitope description:EEADVRNQAETLVYQTEKFVKEQRETE antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  26. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352219

    Description: epitope description:AEEDRKRREEADVRNQAE antigen name:Chaperone protein DnaK host organism:Oryctolagus cuniculus

    Publication: 7678097;

  27. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1352220

    Description: epitope description:AEEDRKRREEADVRNQAE antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;

  28. Structural and functional characterization of a monoclonal antibody specific for the preS1 region of hepatitis B virus.

    ID: 1352244

    Description: epitope description:NTANPDW antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:5a19

    Publication: 11749974;

  29. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352245

    Description: epitope description:ANVVGTRQ antigen name:Immunogenic protein MPB70 host organism:Mus musculus antibody name:SB9

    Publication: 1691265;

  30. Structural and functional characterization of a monoclonal antibody specific for the preS1 region of hepatitis B virus.

    ID: 1352249

    Description: epitope description:NTANPDW antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:5a19

    Publication: 11749974;

  31. Behavior of a short preS1 epitope on the surface of hepatitis B core particles.

    ID: 1352251

    Description: epitope description:DPAFR antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:MA-18/7

    Publication: 10223334;

  32. Epitope mapping of twelve monoclonal antibodies against the phenolic glycolipid-I of M. leprae.

    ID: 1352283

    Description: epitope description:beta-D-Glcp3,6Me2-(1->4)-alpha-L-Rhap2,3-Me2 antigen name:phenolic glycolipid-1 host organism:Mus musculus antibody name:1-21, 1-2...

    Publication: 9465158;

  33. Epitope mapping of twelve monoclonal antibodies against the phenolic glycolipid-I of M. leprae.

    ID: 1352284

    Description: epitope description:beta-D-Glcp3,6Me2-(1->4)-alpha-L-Rhap2,3-Me2 antigen name:phenolic glycolipid-1 host organism:Mus musculus antibody name:6A12, 8A2...

    Publication: 9465158;

  34. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352309

    Description: epitope description:NVVGTRQ antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  35. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352311

    Description: epitope description:SNNPE antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  36. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352314

    Description: epitope description:VIIEQSWGSP antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens

    Publication: 11803047;

  37. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352317

    Description: epitope description:TVLARSIAKE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens

    Publication: 11803047;

  38. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352320

    Description: epitope description:SKGANPVEIR antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens

    Publication: 11803047;

  39. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352324

    Description: epitope description:ATISANGDKE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens

    Publication: 11803047;

  40. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352346

    Description: epitope description:LKTNSSLL antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  41. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352348

    Description: epitope description:PQVNLVDT antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  42. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352366

    Description: epitope description:ASLLTTAEVV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens

    Publication: 11803047;

  43. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352368

    Description: epitope description:DLVGPGCA antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  44. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352370

    Description: epitope description:VGPGCAEY antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  45. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352375

    Description: epitope description:EYAAANPT antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  46. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352377

    Description: epitope description:AAANPTGP antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  47. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352379

    Description: epitope description:ANPTGPAS antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  48. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352382

    Description: epitope description:TGPASVQG antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  49. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352385

    Description: epitope description:ASVQGMSQ antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  50. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352386

    Description: epitope description:KVTLGPKGRN antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;

  51. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352387

    Description: epitope description:VQGMSQDP antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  52. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352395

    Description: epitope description:PELTTLTA antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  53. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352397

    Description: epitope description:LTTLTAAL antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  54. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352524

    Description: epitope description:RFDKGYISGY antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;

  55. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352533

    Description: epitope description:RRKAMLQDMA antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;

  56. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352539

    Description: epitope description:IKAGAATEVE antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;

  57. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352542

    Description: epitope description:QAAPTLDELK antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;

  58. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352549

    Description: epitope description:GHGLNAQTGV antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;

  59. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352399

    Description: epitope description:TLTAALSG antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  60. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352401

    Description: epitope description:TAALSGQL antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  61. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352402

    Description: epitope description:AALSGQLN antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  62. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352414

    Description: epitope description:DTLNSGQY antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  63. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352415

    Description: epitope description:TLNSGQYT antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  64. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352416

    Description: epitope description:LNSGQYTV antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  65. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352418

    Description: epitope description:SGQYTVFA antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  66. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352424

    Description: epitope description:FAPTNAAF antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  67. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352431

    Description: epitope description:SKLPASTI antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  68. Structures of the glycopeptidolipid antigens of Mycobacterium abscessus and Mycobacterium chelonae and possible chemical basis of the serological cros...

    ID: 1352432

    Description: epitope description:3-O-methyl-alpha-L-rhamnose antigen name:GPL P-II host organism:Oryctolagus cuniculus New Zealand White

    Publication: 8025677;

  69. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352435

    Description: epitope description:PASTIDEL antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  70. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352440

    Description: epitope description:DELKTNSS antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  71. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352443

    Description: epitope description:NSSLLTSI antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  72. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352448

    Description: epitope description:TSILTYHV antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  73. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352449

    Description: epitope description:SILTYHVV antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  74. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352455

    Description: epitope description:VVAGQTSP antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  75. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352457

    Description: epitope description:AGQTSPAN antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  76. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352459

    Description: epitope description:QTSPANVV antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  77. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352460

    Description: epitope description:TSPANVVG antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  78. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352473

    Description: epitope description:ATVYMIDS antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  79. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352476

    Description: epitope description:MIDSVLMP antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  80. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352477

    Description: epitope description:IDSVLMPP antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  81. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352482

    Description: epitope description:VCGGVSTA antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  82. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352486

    Description: epitope description:VSTANATV antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  83. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352497

    Description: epitope description:GNADVVCG antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  84. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352503

    Description: epitope description:ASVTVTGQ antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  85. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352505

    Description: epitope description:VTVTGQGN antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  86. Epitope mapping of the Mycobacterium bovis secretory protein MPB70 using overlapping peptide analysis.

    ID: 1352507

    Description: epitope description:VTGQGNSL antigen name:Immunogenic protein MPB70 host organism:Bos taurus antibody name:Cow serum

    Publication: 1691265;

  87. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352510

    Description: epitope description:KWGAPTITND antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;

  88. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352512

    Description: epitope description:TVLAQALVRE antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;

  89. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352521

    Description: epitope description:ESNTFGLQLE antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;

  90. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352522

    Description: epitope description:GLQLELTEGM antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;

  91. Antibodies against different epitopes of heat-shock protein 60 in children with type 1 diabetes mellitus.

    ID: 1352551

    Description: epitope description:AGLFLTTEAV antigen name:60 kDa chaperonin 2 host organism:Homo sapiens

    Publication: 11803047;

  92. Critical residues of the Mycobacterium leprae LSR recombinant protein discriminate clinical activity in erythema nodosum leprosum reactions.

    ID: 1352571

    Description: epitope description:VTYEIDLTNKNAAKLRGD antigen name:UniProt:B8ZU53 host organism:Homo sapiens

    Publication: 7525491;

  93. Immunogenicity of peptides for B cells is not impaired by overlapping T-cell epitope topology.

    ID: 1352582

    Description: epitope description:AAGNVNI antigen name:Lipoprotein LpqH (UniProt:P9WK61) host organism:Mus musculus BALB/c

    Publication: 8774349;

  94. Immunogenicity of peptides for B cells is not impaired by overlapping T-cell epitope topology.

    ID: 1352590

    Description: epitope description:GFASKTPANQAIS antigen name:Phosphate-binding protein PstS 1 host organism:Mus musculus B10.BR

    Publication: 8774349;

  95. Synthesis and immunoreactivity of neoglycoproteins containing the trisaccharide unit of phenolic glycolipid I of Mycobacterium leprae.

    ID: 1352605

    Description: epitope description:beta-D-Glcp3,6Me2-(1->4)-alpha-L-Rhap2,3-Me2 antigen name:phenolic glycolipid-1 host organism:Homo sapiens

    Publication: 3063383;

  96. Synthesis and immunoreactivity of neoglycoproteins containing the trisaccharide unit of phenolic glycolipid I of Mycobacterium leprae.

    ID: 1352607

    Description: epitope description:beta-D-Glcp3,6Me2-(1->4)-alpha-L-Rhap2,3-Me2 antigen name:phenolic glycolipid-1 host organism:Homo sapiens

    Publication: 3063383;

  97. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352653

    Description: epitope description:KTPGENK antigen name:Variable surface lipoprotein, VspA host organism:Bos taurus

    Publication: 10639433;

  98. Structures of the glycopeptidolipid antigens of serovars 25 and 26 of the Mycobacterium avium serocomplex, synthesis of allyl glycosides of the outer ...

    ID: 1352729

    Description: epitope description:2-Me-alpha-D-Fucp4NAc-(1->4)-beta-D-GlcpA antigen name:GPL-25 host organism:Oryctolagus cuniculus

    Publication: 1284113;

  99. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352775

    Description: epitope description:TLKFEI antigen name:Variable surface lipoprotein, VspF host organism:Bos taurus

    Publication: 10639433;

  100. Epitope mapping of immunogenic and adhesive structures in repetitive domains of Mycoplasma bovis variable surface lipoproteins.

    ID: 1352793

    Description: epitope description:AGTK antigen name:Variable surface lipoprotein, VspA host organism:Mus musculus antibody name:1E5

    Publication: 10639433;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston