Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512059

    Description: epitope description:AKLGAAASSPDA antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  2. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512060

    Description: epitope description:LGAAASSPDAHV antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  3. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512062

    Description: epitope description:ASSPDAHVPFCF antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  4. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512065

    Description: epitope description:HVPFCFGKDLKR antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  5. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512066

    Description: epitope description:PFCFGKDLKRPG antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  6. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512067

    Description: epitope description:CFGKDLKRPGSS antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  7. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512069

    Description: epitope description:DLKRPGSSPMEV antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  8. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512071

    Description: epitope description:PGSSPMEVMLRA antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  9. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1512096

    Description: epitope description:DLKCSLPHRNESNKWTCAARRKGSRRDSLYIAGRDFWGR antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  10. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1512106

    Description: epitope description:KGSRR antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  11. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512121

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  12. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512122

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  13. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512125

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  14. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512127

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  15. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512131

    Description: epitope description:EQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  16. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512139

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  17. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1512140

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  18. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512155

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  19. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512159

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  20. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512164

    Description: epitope description:DLVEYIMNYTGNQQSRWGLGSPNC antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  21. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512165

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  22. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512169

    Description: epitope description:MNYTGNQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  23. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512170

    Description: epitope description:DLVEYIMNYTGNQQSRWGLGSPNC antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  24. An antibody- and synthetic peptide-defined rubella virus E1 glycoprotein neutralization domain.

    ID: 1512174

    Description: epitope description:HGPDWASPVCQRHSPDCSRLVG antigen name:Structural polyprotein host organism:Mus musculus BALB/c

    Publication: 7678312;

  25. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512201

    Description: epitope description:ASSPDAHVPFCFGKDLKRPGSSPME antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  26. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512217

    Description: epitope description:QLTFEGKPALELIRMVECSGKQDCP antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  27. Pathotyping isolates of Newcastle disease virus using antipeptide antibodies to pathotype-specific regions of their fusion and hemagglutinin-neuramini...

    ID: 1512219

    Description: epitope description:VTTSGGGRQG antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 10076509;

  28. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512234

    Description: epitope description:FLGPKQLTFEGKPALELIRMVECSG antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  29. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512238

    Description: epitope description:MVVTSVAMKPYEVTPTRMLVCGIAA antigen name:Pertussis toxin subunit 4 host organism:Oryctolagus cuniculus

    Publication: 7684728;

  30. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512251

    Description: epitope description:AASSPDA antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  31. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1512255

    Description: epitope description:VECSGKQDCP antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  32. Pathotyping isolates of Newcastle disease virus using antipeptide antibodies to pathotype-specific regions of their fusion and hemagglutinin-neuramini...

    ID: 1512298

    Description: epitope description:VTTSGGRRQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 10076509;

  33. Pathotyping isolates of Newcastle disease virus using antipeptide antibodies to pathotype-specific regions of their fusion and hemagglutinin-neuramini...

    ID: 1512302

    Description: epitope description:REARSGRLSQLRE antigen name:Hemagglutinin-neuraminidase host organism:Oryctolagus cuniculus

    Publication: 10076509;

  34. Mutational analysis of the virus and monoclonal antibody binding sites in MHVR, the cellular receptor of the murine coronavirus mouse hepatitis virus ...

    ID: 1512305

    Description: epitope description:L60, A61, L62, G63, A64, F65, A66, D76, K77 antigen name:Carcinoembryonic antigen-related cell adhesion molecule 1 host organism:M...

    Publication: 9499047;

  35. Defining antibody targets in Streptococcus oralis infection.

    ID: 1512324

    Description: epitope description:TMYPNRQPGSGWDSS antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

    Publication: 8613367;

  36. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512326

    Description: epitope description:RGDL antigen name:Polyprotein host organism:Mus musculus antibody name:7FC12, 7AH1, 7JD1, 7CA11

    Publication: 7690714;

  37. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512344

    Description: epitope description:RGDL antigen name:Polyprotein host organism:Mus musculus antibody name:7JD1, 7CA11

    Publication: 7690714;

  38. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512346

    Description: epitope description:RGDL antigen name:Polyprotein host organism:Mus musculus antibody name:7JD1, 7CA11

    Publication: 7690714;

  39. Defining antibody targets in Streptococcus oralis infection.

    ID: 1512355

    Description: epitope description:YPTVV antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

    Publication: 8613367;

  40. Defining antibody targets in Streptococcus oralis infection.

    ID: 1512365

    Description: epitope description:YPTVV antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

    Publication: 8613367;

  41. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512389

    Description: epitope description:RGDLXRGDLXRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  42. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512390

    Description: epitope description:ARGDLAXARGDLAXARGDLA host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  43. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512392

    Description: epitope description:RGDLRGDLRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  44. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512393

    Description: epitope description:RGDLRGDLRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  45. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512404

    Description: epitope description:RGDLRGDLRGDL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  46. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512407

    Description: epitope description:RGDLARGDLARGDL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  47. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512420

    Description: epitope description:RGDLRGDLRGDL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  48. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512424

    Description: epitope description:VARGDLAARGDLAARGDLA host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7690714;

  49. Use of substituted and tandem-repeated peptides to probe the relevance of the highly conserved RGD tripeptide in the immune response against foot-and-...

    ID: 1512425

    Description: epitope description:RGDLXRGDLXRGDL host organism:Cavia porcellus Duncan-Hartley

    Publication: 7690714;

  50. Structure-function analyses of diphtheria toxin by use of monoclonal antibodies.

    ID: 1512451

    Description: epitope description:GVHANLHVAFHRSSSEKIHSNEISSDSIGVLGYQKTVDHTKVNSKLSLFFEIKS antigen name:Diphtheria toxin (UniProt:H2GU79) host organism:Mus musculus B...

    Publication: 7679377;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston