Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Vaccine engineering: enhancement of immunogenicity of synthetic peptide vaccines related to hepatitis in chemically defined models consisting of T- an...

    ID: 1350848

    Description: epitope description:TKPTDGN antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2480595;

  2. Vaccine engineering: enhancement of immunogenicity of synthetic peptide vaccines related to hepatitis in chemically defined models consisting of T- an...

    ID: 1350850

    Description: epitope description:TKPTDGN antigen name:Large envelope protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2480595;

  3. Mapping of the T and B cell epitopes of the Mycobacterium bovis protein, MPB70.

    ID: 1350935

    Description: epitope description:GTRQTLQGASVTVTGQGNSLKVGNADVVCGGVSTANATVYMIDSVLMPPA antigen name:Immunogenic protein MPB70 host organism:Mus musculus antibody name...

    Publication: 1711006;

  4. Characterization of murine B-cell epitopes on the Mycobacterium leprae proline-rich antigen by use of synthetic peptides.

    ID: 1351140

    Description: epitope description:YPPP antigen name:Proline rich antigenic protein host organism:Mus musculus BALB/c antibody name:F67-1, F67-5

    Publication: 1702765;

  5. Allelic subtypic determinants of hepatitis B surface antigen (i and t) that are distinct from d/y or w/r.

    ID: 1351142

    Description: epitope description:TIPAQGTSM antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:I-18

    Publication: 7678309;

  6. Characterization of murine B-cell epitopes on the Mycobacterium leprae proline-rich antigen by use of synthetic peptides.

    ID: 1351149

    Description: epitope description:SYPPP antigen name:Proline rich antigenic protein host organism:Mus musculus BALB/c antibody name:F126-5

    Publication: 1702765;

  7. Allelic subtypic determinants of hepatitis B surface antigen (i and t) that are distinct from d/y or w/r.

    ID: 1351163

    Description: epitope description:TIPAQGTSM antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:I-18

    Publication: 7678309;

  8. Cross-reactive asparagine-rich determinants shared between several blood-stage antigens of Plasmodium falciparum and the circumsporozoite protein.

    ID: 1351267

    Description: epitope description:NPNANPNANPNANPNANPNANPNA antigen name:Circumsporozoite (CS) protein host organism:Aotus trivirgatus

    Publication: 1693414;

  9. Cross-reactive asparagine-rich determinants shared between several blood-stage antigens of Plasmodium falciparum and the circumsporozoite protein.

    ID: 1351270

    Description: epitope description:NNTNNTNNTNNTNNTNNTNNTNNT host organism:Aotus trivirgatus

    Publication: 1693414;

  10. Analysis of B-cell epitopes in the variable C-terminal region of the Mycobacterium leprae 70-kilodalton heat shock protein.

    ID: 1351286

    Description: epitope description:SAPGGSNSTDDVLTRRWSTTNGSPK antigen name:Chaperone protein DnaK host organism:Homo sapiens

    Publication: 7678097;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston