Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351798

    Description: epitope description:EQVLGTSARPAVMPMDAWRE antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  2. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351805

    Description: epitope description:VVTVRAERPGVDPDREMLAA antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 1706384;

  3. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351806

    Description: epitope description:VVTVRAERPGVDPDREMLAA antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  4. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351811

    Description: epitope description:AKPRKISVDRGNNGHQTINK antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 1706384;

  5. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351814

    Description: epitope description:QTINKTAHEIIDA antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  6. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351822

    Description: epitope description:EMLAAERPRGVFNRQLVLGE antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 1706384;

  7. Characterisation of the binding sites of monoclonal antibodies reacting with the Plasmodium falciparum rhoptry protein RhopH3.

    ID: 1347379

    Description: epitope description:LEEAEGTSNLKKGLEFYKSSLKLDQLDKEKPKKKKSKRKKKRD antigen name:RhopH3 host organism:Mus musculus antibody name:95, 96

    Publication: 9106189;

  8. Characterisation of the binding sites of monoclonal antibodies reacting with the Plasmodium falciparum rhoptry protein RhopH3.

    ID: 1347382

    Description: epitope description:SSLKLDQLDKEKPKKKKSKRKKKRDSSSDRILLEESKTFTSENEL antigen name:RhopH3 host organism:Mus musculus antibody name:95

    Publication: 9106189;

  9. Characterisation of the binding sites of monoclonal antibodies reacting with the Plasmodium falciparum rhoptry protein RhopH3.

    ID: 1347387

    Description: epitope description:QGEDKTTDNTYKEMEE antigen name:RhopH3 host organism:Mus musculus BALB/c

    Publication: 9106189;

  10. Binding of low concentration of peptide to H-2Kd produced in insect cells requires mouse beta 2-microglobulin co-expression.

    ID: 1347401

    Description: epitope description:VMVHDPHSLA antigen name:H-2 class I histocompatibility antigen, K-B alpha chain host organism:Oryctolagus cuniculus New Zealand Wh...

    Publication: 1622899;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston