Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Analysis of human antibody epitopes on the 65-kilodalton protein of Mycobacterium leprae by using synthetic peptides.

    ID: 1351736

    Description: epitope description:GGGVTLLQAAPALDKLKLTGDEATGANI antigen name:UniProt:B8ZUA4 host organism:Mus musculus antibody name:2404, 1723

    Publication: 2478477;

  2. Specific and randomly derived immunoactive peptide mimotopes of mycobacterial antigens.

    ID: 1351748

    Description: epitope description:MSPRATI host organism:Mus musculus antibody name:CS-35

    Publication: 16916959;

  3. Specific and randomly derived immunoactive peptide mimotopes of mycobacterial antigens.

    ID: 1351753

    Description: epitope description:SHRLLQTYWSSA host organism:Mus musculus antibody name:CS-35

    Publication: 16916959;

  4. Specific and randomly derived immunoactive peptide mimotopes of mycobacterial antigens.

    ID: 1351766

    Description: epitope description:NLTDILP host organism:Oryctolagus cuniculus antibody name:R1, R2, R3

    Publication: 16916959;

  5. Specific and randomly derived immunoactive peptide mimotopes of mycobacterial antigens.

    ID: 1351771

    Description: epitope description:AVQGFNW host organism:Oryctolagus cuniculus antibody name:R1, R2, R3

    Publication: 16916959;

  6. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351779

    Description: epitope description:DAWREGEEFVVEFDLPGIKA antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  7. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351780

    Description: epitope description:PGIKADSLDIDIERNVVTVR antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 1706384;

  8. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351781

    Description: epitope description:PGIKADSLDIDIERNVVTVR antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  9. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351783

    Description: epitope description:VVTVRAERPGVDPDREMLAA antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  10. Specific and randomly derived immunoactive peptide mimotopes of mycobacterial antigens.

    ID: 1351790

    Description: epitope description:SHRLLQTYWSSA host organism:Oryctolagus cuniculus antibody name:R1, R2, R3

    Publication: 16916959;

  11. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351798

    Description: epitope description:EQVLGTSARPAVMPMDAWRE antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  12. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351805

    Description: epitope description:VVTVRAERPGVDPDREMLAA antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 1706384;

  13. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351806

    Description: epitope description:VVTVRAERPGVDPDREMLAA antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  14. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351811

    Description: epitope description:AKPRKISVDRGNNGHQTINK antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 1706384;

  15. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351814

    Description: epitope description:QTINKTAHEIIDA antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  16. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351822

    Description: epitope description:EMLAAERPRGVFNRQLVLGE antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 1706384;

  17. Characterisation of the binding sites of monoclonal antibodies reacting with the Plasmodium falciparum rhoptry protein RhopH3.

    ID: 1347379

    Description: epitope description:LEEAEGTSNLKKGLEFYKSSLKLDQLDKEKPKKKKSKRKKKRD antigen name:RhopH3 host organism:Mus musculus antibody name:95, 96

    Publication: 9106189;

  18. Characterisation of the binding sites of monoclonal antibodies reacting with the Plasmodium falciparum rhoptry protein RhopH3.

    ID: 1347382

    Description: epitope description:SSLKLDQLDKEKPKKKKSKRKKKRDSSSDRILLEESKTFTSENEL antigen name:RhopH3 host organism:Mus musculus antibody name:95

    Publication: 9106189;

  19. Characterisation of the binding sites of monoclonal antibodies reacting with the Plasmodium falciparum rhoptry protein RhopH3.

    ID: 1347387

    Description: epitope description:QGEDKTTDNTYKEMEE antigen name:RhopH3 host organism:Mus musculus BALB/c

    Publication: 9106189;

  20. Binding of low concentration of peptide to H-2Kd produced in insect cells requires mouse beta 2-microglobulin co-expression.

    ID: 1347401

    Description: epitope description:VMVHDPHSLA antigen name:H-2 class I histocompatibility antigen, K-B alpha chain host organism:Oryctolagus cuniculus New Zealand Wh...

    Publication: 1622899;

  21. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347411

    Description: epitope description:PESNSLTG antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  22. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347415

    Description: epitope description:SLTGLIYA antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  23. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347416

    Description: epitope description:LTGLIYAH antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  24. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347418

    Description: epitope description:GLIYAHTA antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  25. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347422

    Description: epitope description:AHTAHVHK antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  26. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347423

    Description: epitope description:HTAHVHKL antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  27. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347439

    Description: epitope description:NHFSSADE antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  28. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347446

    Description: epitope description:ELIKYLEK antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  29. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347453

    Description: epitope description:KTNINTLE antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  30. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347454

    Description: epitope description:TNINTLEN antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  31. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347456

    Description: epitope description:INTLENSD antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  32. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347460

    Description: epitope description:ENSDHTCF antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  33. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347465

    Description: epitope description:TCFARAVT antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  34. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347472

    Description: epitope description:TLYLFYYY antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  35. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347486

    Description: epitope description:MLSTDDYQ antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  36. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347494

    Description: epitope description:SFFKNKFK antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  37. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347495

    Description: epitope description:FFKNKFKD antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  38. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347501

    Description: epitope description:KDINPLFI antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  39. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347503

    Description: epitope description:INPLFIND antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  40. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347506

    Description: epitope description:LFINDFIL antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  41. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347507

    Description: epitope description:FINDFILI antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  42. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347513

    Description: epitope description:LILNDKKF antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  43. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347517

    Description: epitope description:DKKFMENL antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  44. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347521

    Description: epitope description:MENLDLYI antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  45. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347527

    Description: epitope description:YIMKESER antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  46. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347533

    Description: epitope description:EREHLVIK antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  47. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347536

    Description: epitope description:HLVIKKNP antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  48. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347539

    Description: epitope description:IKKNPFLR antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  49. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347541

    Description: epitope description:KNPFLRVL antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  50. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347542

    Description: epitope description:NPFLRVLN antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  51. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347546

    Description: epitope description:RVLNKAST antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  52. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347548

    Description: epitope description:LNKASTTT antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  53. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347561

    Description: epitope description:YNRYFIVG antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  54. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347568

    Description: epitope description:GSRVHTPY antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  55. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347572

    Description: epitope description:HTPYKDYF antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  56. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347580

    Description: epitope description:GDFNKYTE antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  57. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347596

    Description: epitope description:CYSRQYSNR antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  58. A peptide derived from a B cell epitope of Plasmodium falciparum rhoptry associated protein 2 specifically raises antibodies to rhoptry associated pro...

    ID: 1347597

    Description: epitope description:CETEFSKLY antigen name:Rhoptry-associated protein 2, RAP2 host organism:Mus musculus

    Publication: 8946383;

  59. Effect of adjuvant formulations on the selection of B-cell epitopes expressed by a malaria peptide vaccine.

    ID: 1347614

    Description: epitope description:NAGGNAGGNAGGNAGGNAGG antigen name:Circumsporozoite protein host organism:Mus musculus ICR

    Publication: 1377851;

  60. Two distinct but overlapping antibody binding sites in the pre-S(2) region of HBsAg localized within 11 continuous residues.

    ID: 1347618

    Description: epitope description:DPRVRGLYFPA antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:5520, 5521 and 5535

    Publication: 2428872;

  61. Fine specificities of monoclonal antibodies against the Plasmodium falciparum circumsporozoite protein: recognition of both repetitive and non-repetit...

    ID: 1347624

    Description: epitope description:PNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus antibody name:5G5.3

    Publication: 2052404;

  62. Two distinct but overlapping antibody binding sites in the pre-S(2) region of HBsAg localized within 11 continuous residues.

    ID: 1347714

    Description: epitope description:DPRVRGLYFPA antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:4408 and 5161

    Publication: 2428872;

  63. Quantitative analysis of IgA-subclass antibodies against tetanus toxoid.

    ID: 1348536

    Description: epitope description:SLTLGGELCIKIKNEDLTFIAEK antigen name:Tetanus toxin host organism:Homo sapiens

    Publication: 7593647;

  64. Quantitative analysis of IgA-subclass antibodies against tetanus toxoid.

    ID: 1348537

    Description: epitope description:FIAEKNSFSEEPFQDEIVSYNTK antigen name:Tetanus toxin host organism:Homo sapiens

    Publication: 7593647;

  65. Quantitative analysis of IgA-subclass antibodies against tetanus toxoid.

    ID: 1348538

    Description: epitope description:SYNTKNKPLNFNYSLDKIPVTKG antigen name:Tetanus toxin host organism:Homo sapiens

    Publication: 7593647;

  66. Quantitative analysis of IgA-subclass antibodies against tetanus toxoid.

    ID: 1348550

    Description: epitope description:TVNTQFQKRSYQMYRSLETQVDA antigen name:Tetanus toxin host organism:Homo sapiens

    Publication: 7593647;

  67. Quantitative analysis of IgA-subclass antibodies against tetanus toxoid.

    ID: 1348556

    Description: epitope description:KNLDCWVDNEEDIDVILKKSTIL antigen name:Tetanus toxin host organism:Homo sapiens

    Publication: 7593647;

  68. Quantitative analysis of IgA-subclass antibodies against tetanus toxoid.

    ID: 1348557

    Description: epitope description:KSTILNLDINNDIISDISGFNSS antigen name:Tetanus toxin host organism:Homo sapiens

    Publication: 7593647;

  69. Quantitative analysis of IgA-subclass antibodies against tetanus toxoid.

    ID: 1348559

    Description: epitope description:NGKAIHLVNNESSEVIVHKAMDI antigen name:Tetanus toxin host organism:Homo sapiens

    Publication: 7593647;

  70. Immunogens containing sequences from antigen Pf332 induce Plasmodium falciparum-reactive antibodies which inhibit parasite growth but not cytoadherenc...

    ID: 1349166

    Description: epitope description:TVAEEHVEEPTVAEE antigen name:DNAJ protein, putative host organism:Homo sapiens antibody name:33G2

    Publication: 8552406;

  71. Location and chemical synthesis of a pre-S gene coded immunodominant epitope of hepatitis B virus.

    ID: 1349167

    Description: epitope description:MQWNSTALHQALQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 6200931;

  72. B- and T-cell responses in congenic mice to repeat sequences of the malaria antigen Pf332: effects of the number of repeats.

    ID: 1349180

    Description: epitope description:SVTEEIAEEDKSVTEE host organism:Mus musculus B10.BR

    Publication: 8088872;

  73. B- and T-cell responses in congenic mice to repeat sequences of the malaria antigen Pf332: effects of the number of repeats.

    ID: 1349198

    Description: epitope description:SVTEEIAEEDK antigen name:Antigen 332, DBL-like protein host organism:Mus musculus B10.BR

    Publication: 8088872;

  74. Influence of immunoadjuvants and a promiscous T-cell determinant on the immunogenicity of RESA peptide antigen of P. falciparum.

    ID: 1349201

    Description: epitope description:EENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Mus musculus SJL

    Publication: 9754674;

  75. A synthetic peptide elicits antibody reactive with the native duck hepatitis B virus pre-S protein.

    ID: 1349204

    Description: epitope description:MGQHPAKSMDVRR antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 2230741;

  76. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349211

    Description: epitope description:GDRADGQAAGDRADGQAA host organism:Homo sapiens antibody name:immune sera

    Publication: 9149283;

  77. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349214

    Description: epitope description:GDRAAGQAAGDRAAGQAA antigen name:Circumsporozoite protein, putative host organism:Homo sapiens antibody name:immune sera

    Publication: 9149283;

  78. Products of the ""X"" gene in hepatitis B and related viruses.

    ID: 1349221

    Description: epitope description:LPAMSTTDLEAYFKDC antigen name:Protein X host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 2420692;

  79. Products of the ""X"" gene in hepatitis B and related viruses.

    ID: 1349224

    Description: epitope description:CVFKDWEELGEEIRLKV antigen name:Protein X host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 2420692;

  80. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349284

    Description: epitope description:GDRADGQPAGDRADGQPAGDRADGQPAGDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus lemurinus antibody name:a...

    Publication: 9149283;

  81. Influence of immunoadjuvants and a promiscous T-cell determinant on the immunogenicity of RESA peptide antigen of P. falciparum.

    ID: 1349290

    Description: epitope description:EENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Mus musculus SJL

    Publication: 9754674;

  82. In human malaria protective antibodies are directed mainly against the Lys-Glu ion pair within the Lys-Glu-Lys motif of the synthetic vaccine SPf 66.

    ID: 1349300

    Description: epitope description:YSLFQKEK antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 1557226;

  83. In human malaria protective antibodies are directed mainly against the Lys-Glu ion pair within the Lys-Glu-Lys motif of the synthetic vaccine SPf 66.

    ID: 1349307

    Description: epitope description:VDYLEEKTKDQDL antigen name:Rhoptry-associated protein 1, RAP1 host organism:Homo sapiens

    Publication: 1557226;

  84. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349326

    Description: epitope description:FNNFTVSFWLRVPKVSASHLE antigen name:Tetanus toxin host organism:Aotus lemurinus antibody name:anti-MAP IV

    Publication: 9149283;

  85. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349330

    Description: epitope description:GDRADGQPAGDRADGQPAGDRADGQPAGDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus lemurinus antibody name:a...

    Publication: 9149283;

  86. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349333

    Description: epitope description:GDRADGQPAGDRADGQPAGDRADGQPAGDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus lemurinus antibody name:a...

    Publication: 9149283;

  87. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349334

    Description: epitope description:GDRADGQPAGDRADGQPAGDRADGQPAGDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus lemurinus antibody name:a...

    Publication: 9149283;

  88. Hepatitis B virus vaccine: identification of HBsAg/a and HBsAg/d but not HBsAg/y subtype antigenic determinants on a synthetic immunogenic peptide.

    ID: 1349382

    Description: epitope description:KPTDGN antigen name:Large envelope protein host organism:Mus musculus antibody name:Anti-HBsAg

    Publication: 6176997;

  89. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349391

    Description: epitope description:GDRADGQPAGDRADGQPAGDRADGQPAGDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus lemurinus antibody name:a...

    Publication: 9149283;

  90. Antigenicity and immunogenicity of multiple antigen peptides (MAP) containing P. vivax CS epitopes in Aotus monkeys.

    ID: 1349415

    Description: epitope description:GDRADGQPAGDRADGQPAGDRADGQPAGDRADGQPA antigen name:Circumsporozoite protein, putative host organism:Aotus lemurinus antibody name:a...

    Publication: 9149283;

  91. Immunological cross-reactivity between preS2 sequences of the hepatitis B virus envelope proteins corresponding to serological subtypes adw2 and ayw.

    ID: 1349471

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit se...

    Publication: 3657796;

  92. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1352999

    Description: epitope description:DSLDIDIERNVVTVR antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;

  93. Orientation of epitopes influences the immunogenicity of synthetic peptide dimers.

    ID: 1353003

    Description: epitope description:YEKIGAELVKEVAKKTDDVAG antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus

    Publication: 2464496;

  94. Orientation of epitopes influences the immunogenicity of synthetic peptide dimers.

    ID: 1353008

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus

    Publication: 2464496;

  95. Fine mapping of virus-neutralizing epitopes on hepatitis B virus PreS1.

    ID: 1353016

    Description: epitope description:NSNNPDWDF antigen name:Large envelope protein host organism:Mus musculus antibody name:KR127

    Publication: 10772975;

  96. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1353031

    Description: epitope description:VVTVRAERPGVDPDR antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;

  97. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1353032

    Description: epitope description:VVTVRAERPGVDPDR antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;

  98. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1353043

    Description: epitope description:QLVLGENLDTERILAS antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;

  99. Orientation of epitopes influences the immunogenicity of synthetic peptide dimers.

    ID: 1353052

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Mus musculus B10.BR

    Publication: 2464496;

  100. Recognition of Mycobacterium leprae recombinant 18,000 MW epitopes by IgG subclasses in leprosy.

    ID: 1353054

    Description: epitope description:LKLSIPVAERAKPRK antigen name:UniProt:B8ZS71 host organism:Homo sapiens

    Publication: 7538491;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston