Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification of major antigenic domains of duck hepatitis B virus pre-S protein by peptide scanning.

    ID: 1355051

    Description: epitope description:NTLQNQGA antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 7510440;

  2. Identification of major antigenic domains of duck hepatitis B virus pre-S protein by peptide scanning.

    ID: 1355055

    Description: epitope description:NQGAWPAG antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 7510440;

  3. Identification of major antigenic domains of duck hepatitis B virus pre-S protein by peptide scanning.

    ID: 1355066

    Description: epitope description:RVGLSNPT antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 7510440;

  4. Identification of major antigenic domains of duck hepatitis B virus pre-S protein by peptide scanning.

    ID: 1355068

    Description: epitope description:GLSNPTPQ antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 7510440;

  5. Identification of major antigenic domains of duck hepatitis B virus pre-S protein by peptide scanning.

    ID: 1355070

    Description: epitope description:SNPTPQEI antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 7510440;

  6. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345249

    Description: epitope description:LNYKQEGD antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  7. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345131

    Description: epitope description:NLKAKIND antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  8. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345148

    Description: epitope description:VKITKLSD antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  9. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345150

    Description: epitope description:ITKLSDLK antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  10. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345151

    Description: epitope description:TKLSDLKA antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  11. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345161

    Description: epitope description:DKIDLFKN antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  12. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345166

    Description: epitope description:FKNHNDFE antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  13. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345170

    Description: epitope description:NDFEAIKK antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  14. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345173

    Description: epitope description:EAIKKLIN antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  15. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345180

    Description: epitope description:NDDTKKDM antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  16. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345183

    Description: epitope description:TKKDMLGK antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  17. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345185

    Description: epitope description:KDMLGKLL antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  18. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345188

    Description: epitope description:LGKLLSTG antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  19. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345194

    Description: epitope description:TGLVQNFP antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  20. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345201

    Description: epitope description:PNTIISKL antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  21. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345203

    Description: epitope description:TIISKLIE antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  22. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345204

    Description: epitope description:IISKLIEG antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  23. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345208

    Description: epitope description:LIEGKFQD antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  24. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345210

    Description: epitope description:EGKFQDML antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  25. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345231

    Description: epitope description:ENSGCFRH antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  26. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345234

    Description: epitope description:GCFRHLDE antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  27. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345235

    Description: epitope description:CFRHLDER antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  28. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345237

    Description: epitope description:RHLDEREE antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  29. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345238

    Description: epitope description:HLDEREEC antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  30. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345244

    Description: epitope description:ECKCLLNY antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  31. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345258

    Description: epitope description:CVENPNPT antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  32. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345259

    Description: epitope description:VENPNPTC antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  33. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345263

    Description: epitope description:NPTCNENN antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  34. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345271

    Description: epitope description:DAKCTEED antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  35. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345272

    Description: epitope description:AKCTEEDS antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  36. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345276

    Description: epitope description:EEDSGSNG antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  37. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345283

    Description: epitope description:GKKITCEC antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  38. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345297

    Description: epitope description:PLFDGIFC antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  39. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345302

    Description: epitope description:IFCSSSNF antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  40. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345305

    Description: epitope description:SSSNFLGI antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  41. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345313

    Description: epitope description:SFLLILML antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  42. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345318

    Description: epitope description:LMLILYSF antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  43. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345327

    Description: epitope description:NVLQNFSVF antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  44. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345328

    Description: epitope description:VIKEEKEKFPS antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  45. Merozoite surface protein-1 epitopes recognized by antibodies that inhibit Plasmodium falciparum merozoite dispersal.

    ID: 1345330

    Description: epitope description:PTCNENNGGC antigen name:Merozoite surface protein 1 host organism:Aotus antibody name:ICM-derived antibodies

    Publication: 9497045;

  46. Characterization of human T- and B-cell epitopes in the C terminus of Plasmodium falciparum merozoite surface protein 1: evidence for poor T-cell reco...

    ID: 1345380

    Description: epitope description:NNGGCDADAKCTEEDSGSNGKKITC antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 9234749;

  47. Characterization of human T- and B-cell epitopes in the C terminus of Plasmodium falciparum merozoite surface protein 1: evidence for poor T-cell reco...

    ID: 1345381

    Description: epitope description:SGSNGKKITCECTKPDSYPLFDGIF antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 9234749;

  48. Characterization of human T- and B-cell epitopes in the C terminus of Plasmodium falciparum merozoite surface protein 1: evidence for poor T-cell reco...

    ID: 1345388

    Description: epitope description:KCVENPNPTCNENNGGCDADATCTE antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 9234749;

  49. Immunogenicity of synthetic peptides derived from Plasmodium falciparum proteins.

    ID: 1345596

    Description: epitope description:AHHAADAHHAADAHHAADAHHAAD host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16513113;

  50. Immune responses to the 18-kDa protein of Mycobacterium leprae. Similar B cell epitopes but different T cell epitopes seen by inbred strains of mice.

    ID: 1351856

    Description: epitope description:PGIKADSLDIDIERNVVTVR antigen name:UniProt:B8ZS71 host organism:Mus musculus B10.BR antibody name:Mouse sera

    Publication: 1706384;

  51. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352009

    Description: epitope description:IIEGMKFDRG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Human s...

    Publication: 13679392;

  52. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352021

    Description: epitope description:EKRIQEIIEQ antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Human s...

    Publication: 13679392;

  53. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352023

    Description: epitope description:LDVTTSEYEK antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Human s...

    Publication: 13679392;

  54. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352024

    Description: epitope description:LAKLSDGVAV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Human s...

    Publication: 13679392;

  55. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352025

    Description: epitope description:DGVAVLKVGG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Human s...

    Publication: 13679392;

  56. Characterization of an antibody-binding epitope from the 18-kDa protein on Mycobacterium leprae.

    ID: 1352035

    Description: epitope description:VLKLSI antigen name:UniProt:B8ZS71 host organism:Mus musculus BALB/c antibody name:L5

    Publication: 2465346;

  57. Importance of subtype in the immune response to the pre-S(2) region of the hepatitis B surface antigen. II. Synthetic Pre-S(2) immunogen.

    ID: 1352037

    Description: epitope description:DPRVRGLYF antigen name:Large envelope protein host organism:Mus musculus C57BL/10

    Publication: 1691763;

  58. Importance of subtype in the immune response to the pre-S(2) region of the hepatitis B surface antigen. II. Synthetic Pre-S(2) immunogen.

    ID: 1352043

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Mus musculus C57BL/10 X DBA/2

    Publication: 1691763;

  59. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352050

    Description: epitope description:MQSSSEVGYD antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Human s...

    Publication: 13679392;

  60. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352053

    Description: epitope description:ASLLTTAEVV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Homo sapiens antibody name:Human s...

    Publication: 13679392;

  61. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352062

    Description: epitope description:PKGRNVVLEK antigen name:60 kDa chaperonin 2 host organism:Homo sapiens antibody name:Human sera

    Publication: 13679392;

  62. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352075

    Description: epitope description:AAISAGDQSI antigen name:60 kDa chaperonin 2 host organism:Homo sapiens antibody name:Human sera

    Publication: 13679392;

  63. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352081

    Description: epitope description:ERQEAVLEDP antigen name:60 kDa chaperonin 2 host organism:Homo sapiens antibody name:Human sera

    Publication: 13679392;

  64. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352084

    Description: epitope description:TVKDLLPLLE antigen name:60 kDa chaperonin 2 host organism:Homo sapiens antibody name:Human sera

    Publication: 13679392;

  65. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352092

    Description: epitope description:GVTLLQAAPT antigen name:60 kDa chaperonin 2 host organism:Homo sapiens antibody name:Human sera

    Publication: 13679392;

  66. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352094

    Description: epitope description:IRQEIENSDS antigen name:60 kDa chaperonin 2 host organism:Homo sapiens antibody name:Human sera

    Publication: 13679392;

  67. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352096

    Description: epitope description:GGVAVIKAGA antigen name:60 kDa chaperonin 2 host organism:Homo sapiens antibody name:Human sera

    Publication: 13679392;

  68. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352097

    Description: epitope description:IKAGAATEVE antigen name:60 kDa chaperonin 2 host organism:Homo sapiens antibody name:Human sera

    Publication: 13679392;

  69. Comparative analysis of linear antibody epitopes on human and mycobacterial 60-kDa heat shock proteins using samples of healthy blood donors.

    ID: 1352106

    Description: epitope description:NAASIAGLFL antigen name:60 kDa chaperonin 2 host organism:Homo sapiens antibody name:Human sera

    Publication: 13679392;

  70. Importance of subtype in the immune response to the pre-S(2) region of the hepatitis B surface antigen. II. Synthetic Pre-S(2) immunogen.

    ID: 1352114

    Description: epitope description:DPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTN antigen name:Large envelope protein host organism:Mus musculus B10.S

    Publication: 1691763;

  71. Mapping of B-cell epitopes of the human hepatitis B virus X protein.

    ID: 1368853

    Description: epitope description:PARDVLCLRPVGAES antigen name:Protein X host organism:Homo sapiens

    Publication: 1692348;

  72. Mapping of B-cell epitopes of the human hepatitis B virus X protein.

    ID: 1368855

    Description: epitope description:VGAESCGRPFSGSLG antigen name:Protein X host organism:Homo sapiens

    Publication: 1692348;

  73. Mapping of B-cell epitopes of the human hepatitis B virus X protein.

    ID: 1368857

    Description: epitope description:VGAESCGRPFSGSLG antigen name:Protein X host organism:Homo sapiens

    Publication: 1692348;

  74. Mapping of B-cell epitopes of the human hepatitis B virus X protein.

    ID: 1368866

    Description: epitope description:AHLSLRGLPVCAFSS antigen name:Protein X host organism:Homo sapiens

    Publication: 1692348;

  75. Mapping of B-cell epitopes of the human hepatitis B virus X protein.

    ID: 1368867

    Description: epitope description:CAFSSAGPCALRFTS antigen name:Protein X host organism:Homo sapiens

    Publication: 1692348;

  76. Mapping of B-cell epitopes of the human hepatitis B virus X protein.

    ID: 1368870

    Description: epitope description:LRFTSARRMETTVN antigen name:Protein X host organism:Homo sapiens

    Publication: 1692348;

  77. Mapping of B-cell epitopes of the human hepatitis B virus X protein.

    ID: 1368877

    Description: epitope description:KVLHKRTLGLSAMSTT antigen name:Protein X host organism:Homo sapiens

    Publication: 1692348;

  78. Mapping of B-cell epitopes of the human hepatitis B virus X protein.

    ID: 1368888

    Description: epitope description:VFVLGGCRHKLVCAPAPCNF antigen name:Protein X host organism:Homo sapiens

    Publication: 1692348;

  79. Mapping of B-cell epitopes of the human hepatitis B virus X protein.

    ID: 1368889

    Description: epitope description:VFVLGGCRHKLVCAPAPCNF antigen name:Protein X host organism:Homo sapiens

    Publication: 1692348;

  80. Mapping of B-cell epitopes of the human hepatitis B virus X protein.

    ID: 1368893

    Description: epitope description:LVCAPAPCNFFTSA antigen name:Protein X host organism:Homo sapiens

    Publication: 1692348;

  81. Identifying epitopes responsible for neutralizing antibody and DC-SIGN binding on the spike glycoprotein of the severe acute respiratory syndrome coro...

    ID: 1368899

    Description: epitope description:NYNWKR host organism:Mus musculus BALB/c antibody name:SIb4

    Publication: 17041212;

  82. Mutation analysis of the fusion domain region of St. Louis encephalitis virus envelope protein.

    ID: 1368906

    Description: epitope description:G106 antigen name:polyprotein host organism:Mus musculus antibody name:6B4A-10

    Publication: 17157348;

  83. Mutation analysis of the fusion domain region of St. Louis encephalitis virus envelope protein.

    ID: 1368908

    Description: epitope description:G106, L107 antigen name:polyprotein host organism:Mus musculus antibody name:1B2C-5

    Publication: 17157348;

  84. A study on antigenicity and receptor-binding ability of fragment 450-650 of the spike protein of SARS coronavirus.

    ID: 1368910

    Description: epitope description:CGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTD antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 17055551;

  85. Identifying epitopes responsible for neutralizing antibody and DC-SIGN binding on the spike glycoprotein of the severe acute respiratory syndrome coro...

    ID: 1368911

    Description: epitope description:NYNWKR host organism:Mus musculus BALB/c antibody name:SIb4

    Publication: 17041212;

  86. A study on antigenicity and receptor-binding ability of fragment 450-650 of the spike protein of SARS coronavirus.

    ID: 1368924

    Description: epitope description:VNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDI antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 17055551;

  87. A single 10-residue pre-S(1) peptide can prime T cell help for antibody production to multiple epitopes within the pre-S(1), pre-S(2), and S regions o...

    ID: 1368942

    Description: epitope description:LGFFPDHQLDP antigen name:Large envelope protein host organism:Mus musculus SJL

    Publication: 2438344;

  88. Mimicry of native peptide antigens by the corresponding retro-inverso analogs is dependent on their intrinsic structure and interaction propensities.

    ID: 1369141

    Description: epitope description:GFAPDLQ + AMID(G1) host organism:Mus musculus antibody name:282, 283, 287

    Publication: 12538696;

  89. Mimicry of native peptide antigens by the corresponding retro-inverso analogs is dependent on their intrinsic structure and interaction propensities.

    ID: 1369142

    Description: epitope description:QLDPAFG antigen name:Large envelope protein host organism:Mus musculus antibody name:282, 283, 287

    Publication: 12538696;

  90. Human monoclonal antibody combination against SARS coronavirus: synergy and coverage of escape mutants.

    ID: 1369150

    Description: epitope description:P462 antigen name:Spike glycoprotein host organism:Homo sapiens antibody name:CR3014

    Publication: 16796401;

  91. Mapping of immunodominant B-cell epitopes and the human serum albumin-binding site in natural hepatitis B virus surface antigen of defined genosubtype...

    ID: 1369174

    Description: epitope description:MQWNST + GLYC(N4) antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:1-8H1

    Publication: 10644835;

  92. Mapping of immunodominant B-cell epitopes and the human serum albumin-binding site in natural hepatitis B virus surface antigen of defined genosubtype...

    ID: 1369256

    Description: epitope description:TVSPISSIFSR antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:1-9D1

    Publication: 10644835;

  93. Mapping of immunodominant B-cell epitopes and the human serum albumin-binding site in natural hepatitis B virus surface antigen of defined genosubtype...

    ID: 1369264

    Description: epitope description:VRGLYFP antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:2-12F2

    Publication: 10644835;

  94. Identification of neutralizing linear epitopes from the VP1 capsid protein of Enterovirus 71 using synthetic peptides.

    ID: 1369322

    Description: epitope description:PESRESLAWQTATNP antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 17222936;

  95. Identification of neutralizing linear epitopes from the VP1 capsid protein of Enterovirus 71 using synthetic peptides.

    ID: 1369328

    Description: epitope description:YPTFGEHKQEKDLEY antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 17222936;

  96. Identification of neutralizing linear epitopes from the VP1 capsid protein of Enterovirus 71 using synthetic peptides.

    ID: 1369338

    Description: epitope description:YPTFGEHKQEKDLEY antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 17222936;

  97. Antigenic and cellular localisation analysis of the severe acute respiratory syndrome coronavirus nucleocapsid protein using monoclonal antibodies.

    ID: 1369345

    Description: epitope description:A274, F275, G276, R277, R278, G279, P280, E281, Q282, T283, K373, K374, K375, K376, T377, D378, E379, A380, Q381, P382 antigen nam...

    Publication: 16920216;

  98. Selection of SARS-coronavirus-specific B cell epitopes by phage peptide library screening and evaluation of the immunological effect of epitope-based ...

    ID: 1369347

    Description: epitope description:NLPSTETRHVTR host organism:Homo sapiens

    Publication: 17055022;

  99. Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

    ID: 1369354

    Description: epitope description:SGIIESGVQNIDDNYFY antigen name:Toxin B host organism:Mus musculus Swiss Webster

    Publication: 8636964;

  100. Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

    ID: 1369355

    Description: epitope description:GIVQIGVFDTSDGYKYFAPANTVND antigen name:Toxin B host organism:Mus musculus Swiss Webster

    Publication: 8636964;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston