Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

ID: 1369356

Description: epitope description:YKYFAPANTVNDNIYGQAVEYSGLV antigen name:Toxin B host organism:Mus musculus Swiss Webster

Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

ID: 1369361

Description: epitope description:KGINLIDDIKYYFDEKGIMRTGLIS antigen name:Toxin B host organism:Mus musculus Swiss Webster

Identification of a B-cell antigenic epitope at the N-terminus of SARS-CoV M protein and characterization of monoclonal antibody against the protein.

ID: 1369498

Description: epitope description:LEQWNLVIGFLFL antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:3H9

Identification of a B-cell antigenic epitope at the N-terminus of SARS-CoV M protein and characterization of monoclonal antibody against the protein.

ID: 1369499

Description: epitope description:LEQWNLVIGFLFL antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:3H9

Selection of SARS-coronavirus-specific B cell epitopes by phage peptide library screening and evaluation of the immunological effect of epitope-based ...

ID: 1369521

Description: epitope description:TRYNDALSHDRL host organism:Homo sapiens

Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

ID: 1369530

Description: epitope description:GKLIIDENIYYFDDNYRGAVE antigen name:Toxin B host organism:Mus musculus Swiss Webster

Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

ID: 1369535

Description: epitope description:YKYFAPANTVNDNIYGQAVEYSGLV antigen name:Toxin B host organism:Mus musculus Swiss Webster

Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

ID: 1369552

Description: epitope description:GKLIIDENIYYFDDNYRGAVE antigen name:Toxin B host organism:Mus musculus Swiss Webster

Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

ID: 1369555

Description: epitope description:SGIIESGVQNIDDNYFY antigen name:Toxin B host organism:Mus musculus Swiss Webster

Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

ID: 1369558

Description: epitope description:IYGQAVEYSGLVRVGEDVYYFGETY antigen name:Toxin B host organism:Mus musculus Swiss Webster

Antigenicity of amino-acid sequences from Clostridium difficile toxin B.

ID: 1369561

Description: epitope description:IETGWIYDMENESDKYYFNPETKKA antigen name:Toxin B host organism:Mus musculus Swiss Webster

Generation of monoclonal antibody recognized by the GXXXG motif (glycine zipper) of prion protein.

ID: 1369567

Description: epitope description:GAVVGGLGGYML antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null antibody name:1...

Generation of monoclonal antibody recognized by the GXXXG motif (glycine zipper) of prion protein.

ID: 1369570

Description: epitope description:GAVVGGLGGYML antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus musculus PrP null antibody name:1...

Selection of SARS-coronavirus-specific B cell epitopes by phage peptide library screening and evaluation of the immunological effect of epitope-based ...

ID: 1369614

Description: epitope description:ATEKSNVVRGWV antigen name:Spike glycoprotein host organism:Homo sapiens

Cryptic properties of a cluster of dominant flavivirus cross-reactive antigenic sites.

ID: 1369615

Description: epitope description:L482 antigen name:Genome polyprotein host organism:Mus musculus antibody name:A1, A2

Cryptic properties of a cluster of dominant flavivirus cross-reactive antigenic sites.

ID: 1369642

Description: epitope description:G104, G106, E126, W231 antigen name:Genome polyprotein host organism:Mus musculus antibody name:6B6C1

Cryptic properties of a cluster of dominant flavivirus cross-reactive antigenic sites.

ID: 1369644

Description: epitope description:G104, G106, E126, W231 antigen name:Genome polyprotein host organism:Mus musculus antibody name:6B6C1

Cryptic properties of a cluster of dominant flavivirus cross-reactive antigenic sites.

ID: 1369654

Description: epitope description:G104, G106, E126, W231 antigen name:Genome polyprotein host organism:Mus musculus antibody name:6B6C1

Synthesis and antigenic analysis of the BclA glycoprotein oligosaccharide from the Bacillus anthracis exosporium.

ID: 1369686

Description: epitope description:2-O-methyl-4-(3-hydroxy-3-methylbutamido)-4,6-dideoxy-beta-D-glucosyl-(1->3)-alpha-L-rhamnosyl-(1->2)-alpha-L-rhamnosyl group anti...

Aldehyde modification of peptide immunogen enhances protein-reactive antibody response to toxic shock syndrome toxin-1.

ID: 1369689

Description: epitope description:STNDNIKDLLDWYSSG antigen name:UniProt:D6SEW7 host organism:Oryctolagus cuniculus New Zealand White

Selection of SARS-coronavirus-specific B cell epitopes by phage peptide library screening and evaluation of the immunological effect of epitope-based ...

ID: 1369694

Description: epitope description:NTRNIDATSTGN antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Selection of SARS-coronavirus-specific B cell epitopes by phage peptide library screening and evaluation of the immunological effect of epitope-based ...

ID: 1369697

Description: epitope description:NTRNIDATSTGN antigen name:Spike glycoprotein host organism:Homo sapiens

Selection of SARS-coronavirus-specific B cell epitopes by phage peptide library screening and evaluation of the immunological effect of epitope-based ...

ID: 1369698

Description: epitope description:PFSPDGKPCTPP antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Selection of SARS-coronavirus-specific B cell epitopes by phage peptide library screening and evaluation of the immunological effect of epitope-based ...

ID: 1369705

Description: epitope description:HEGKAYFPREGV antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Aldehyde modification of peptide immunogen enhances protein-reactive antibody response to toxic shock syndrome toxin-1.

ID: 1369712

Description: epitope description:SPAFTKGEKVDLN antigen name:UniProt:D6SEW7 host organism:Oryctolagus cuniculus New Zealand White

Aldehyde modification of peptide immunogen enhances protein-reactive antibody response to toxic shock syndrome toxin-1.

ID: 1369713

Description: epitope description:SPAFTKGEKVDLN antigen name:UniProt:D6SEW7 host organism:Oryctolagus cuniculus New Zealand White

Aldehyde modification of peptide immunogen enhances protein-reactive antibody response to toxic shock syndrome toxin-1.

ID: 1369714

Description: epitope description:SPAFTKGEKVDLN antigen name:UniProt:D6SEW7 host organism:Oryctolagus cuniculus New Zealand White

Cryptic properties of a cluster of dominant flavivirus cross-reactive antigenic sites.

ID: 1369723

Description: epitope description:G104, G106, L107, W231 antigen name:Genome polyprotein host organism:Mus musculus antibody name:4G2

Development of an OspC-based tetravalent, recombinant, chimeric vaccinogen that elicits bactericidal antibody against diverse Lyme disease spirochete ...

ID: 1369732

Description: epitope description:LKANAAGKDKGVEELEKLSGSLESLSKAAKEMLANSVKELTS antigen name:UniProt:C0R7B3 host organism:Mus musculus C3H/He antibody name:Anti-ABKD s...

Development of an OspC-based tetravalent, recombinant, chimeric vaccinogen that elicits bactericidal antibody against diverse Lyme disease spirochete ...

ID: 1369733

Description: epitope description:LITDAAKDKGAAELEKLFKAVENLAKAAKEMLANSVKELTS antigen name:Other Borreliella burgdorferi (Lyme disease spirochete) protein host organi...

Development of an OspC-based tetravalent, recombinant, chimeric vaccinogen that elicits bactericidal antibody against diverse Lyme disease spirochete ...

ID: 1369736

Description: epitope description:LKANAAGKDKGVEELEKLSGSLESLSKAAKEMLANSVKELTS antigen name:UniProt:C0R7B3 host organism:Mus musculus C3H/He antibody name:Anti-ABKD s...

Development of an OspC-based tetravalent, recombinant, chimeric vaccinogen that elicits bactericidal antibody against diverse Lyme disease spirochete ...

ID: 1369739

Description: epitope description:SETFTNKLKEKHTDLGKEG antigen name:Outer surface protein C host organism:Mus musculus C3H/He antibody name:Anti-ABKD sera

Epitope mapping of a monoclonal antibody specific for human herpesvirus 6 variant A immediate-early 2 protein.

ID: 1369749

Description: epitope description:FTPFYYQSSRTR antigen name:Immediate-early protein 2 host organism:Mus musculus BALB/c antibody name:P6H8

Analysis of antibody response in humans to the type A OspC loop 5 domain and assessment of the potential utility of the loop 5 epitope in Lyme disease...

ID: 1369831

Description: epitope description:CSETFTNKLKEKH antigen name:Outer surface protein C host organism:Homo sapiens

Analysis of antibody response in humans to the type A OspC loop 5 domain and assessment of the potential utility of the loop 5 epitope in Lyme disease...

ID: 1369832

Description: epitope description:CSETFTNKLKEKH antigen name:Outer surface protein C host organism:Mus musculus

Hepatitis C virus continuously escapes from neutralizing antibody and T-cell responses during chronic infection in vivo.

ID: 1369897

Description: epitope description:HVNGRTTALVGLLTPAKN host organism:Homo sapiens

Induction of neutralizing antibody responses to hepatitis C virus with synthetic peptide constructs incorporating both antibody and T-helper epitopes.

ID: 1369907

Description: epitope description:ETHVTGGSAGRTTAGLVGLLTPGAKQN antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Induction of neutralizing antibody responses to hepatitis C virus with synthetic peptide constructs incorporating both antibody and T-helper epitopes.

ID: 1369920

Description: epitope description:SLNTGWLAGLFY antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Induction of neutralizing antibody responses to hepatitis C virus with synthetic peptide constructs incorporating both antibody and T-helper epitopes.

ID: 1369922

Description: epitope description:TAGLVGLLTPGA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

Alanine-scanning mutations in domain 4 of anthrax toxin protective antigen reveal residues important for binding to the cellular receptor and to a neu...

ID: 1369941

Description: epitope description:N711, K713, L714, P715, L716, Y717 antigen name:Protective antigen host organism:Mus musculus BALB/c antibody name:14B7

Locations of antibody binding sites within conserved regions of the hepatitis C virus core protein.

ID: 1369949

Description: epitope description:KTSERSQPRG antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Human sera

Analysis of antibody response in humans to the type A OspC loop 5 domain and assessment of the potential utility of the loop 5 epitope in Lyme disease...

ID: 1369985

Description: epitope description:LKEKHTDLGKEGV antigen name:Outer surface protein C host organism:Mus musculus

Common peptide epitope in mumps virus nucleocapsid protein and MHC class II-associated invariant chain.

ID: 1369995

Description: epitope description:AYFLYQQQGRLDKL antigen name:HLA class II histocompatibility antigen gamma chain (UniProt:P04233) host organism:Oryctolagus cunicul...

Analysis of antibody response in humans to the type A OspC loop 5 domain and assessment of the potential utility of the loop 5 epitope in Lyme disease...

ID: 1369996

Description: epitope description:HTDLGKEGVTDAD antigen name:Outer surface protein C host organism:Homo sapiens

Analysis of antibody response in humans to the type A OspC loop 5 domain and assessment of the potential utility of the loop 5 epitope in Lyme disease...

ID: 1369997

Description: epitope description:HTDLGKEGVTDAD antigen name:Outer surface protein C host organism:Mus musculus

Analysis of antibody response in humans to the type A OspC loop 5 domain and assessment of the potential utility of the loop 5 epitope in Lyme disease...

ID: 1370000

Description: epitope description:GKEGVTDADAKEA antigen name:Outer surface protein C host organism:Homo sapiens

Analysis of antibody response in humans to the type A OspC loop 5 domain and assessment of the potential utility of the loop 5 epitope in Lyme disease...

ID: 1370005

Description: epitope description:VTDADAKEAILKT antigen name:Outer surface protein C host organism:Mus musculus

Conformational changes in the VP1-unique region of native human parvovirus B19 lead to exposure of internal sequences that play a role in virus neutra...

ID: 1370131

Description: epitope description:VTGTDLELIQILK antigen name:Capsid protein VP1 host organism:Homo sapiens antibody name:MAb 1418-1

Hepatitis C virus continuously escapes from neutralizing antibody and T-cell responses during chronic infection in vivo.

ID: 1370135

Description: epitope description:ESLNTGWLAGLP antigen name:Genome polyprotein host organism:Rattus norvegicus antibody name:mAb 2/69a

Vaccination with prion peptide-displaying papillomavirus-like particles induces autoantibodies to normal prion protein that interfere with pathologic ...

ID: 1370145

Description: epitope description:DWEDRYYRE antigen name:Major prion protein host organism:Oryctolagus cuniculus New Zealand White

Vaccination with prion peptide-displaying papillomavirus-like particles induces autoantibodies to normal prion protein that interfere with pathologic ...

ID: 1370146

Description: epitope description:DWEDRYYRE antigen name:Major prion protein host organism:Rattus norvegicus Lewis

Identification of new immunogenic peptides in conserved regions of hepatitis C virus (HCV) 1b with the potentiality to generate cytotoxic T lymphocyte...

ID: 1370185

Description: epitope description:VYHGAGSKTL antigen name:Genome polyprotein host organism:Homo sapiens

Identification of new immunogenic peptides in conserved regions of hepatitis C virus (HCV) 1b with the potentiality to generate cytotoxic T lymphocyte...

ID: 1370188

Description: epitope description:RYAPACKPL antigen name:Genome polyprotein host organism:Homo sapiens

Species-specificity of a panel of prion protein antibodies for the immunohistochemical study of animal and human prion diseases.

ID: 1370208

Description: epitope description:DWEDRYYRE antigen name:Major prion protein host organism:Mus musculus antibody name:143

A single prion protein peptide can elicit a panel of isoform specific monoclonal antibodies.

ID: 1370322

Description: epitope description:CITQYERESQAYY antigen name:Major prion protein host organism:Mus musculus BALB/c

Protective and immunochemical activities of monoclonal antibodies reactive with the Bacillus anthracis polypeptide capsule.

ID: 1370356

Description: epitope description:EEEEE + D-aa(1, 2, 3, 4, 5) antigen name:Other Bacillus anthracis (anthrax bacterium) protein host organism:Mus musculus BALB/c an...

Immunological characterization of abnormal prion protein from atypical scrapie cases in sheep using a panel of monoclonal antibodies.

ID: 1370396

Description: epitope description:GWGQPHGGGWGQPHGGGWGQPHGGGWGQPHG antigen name:Major prion protein host organism:Mus musculus antibody name:SAF32 and SAF34

Immunological characterization of abnormal prion protein from atypical scrapie cases in sheep using a panel of monoclonal antibodies.

ID: 1370400

Description: epitope description:WGQGGSHSQW antigen name:Major prion protein host organism:Mus musculus antibody name:ICSM35

Immunological characterization of abnormal prion protein from atypical scrapie cases in sheep using a panel of monoclonal antibodies.

ID: 1370406

Description: epitope description:YEDRYYRENM antigen name:Major prion protein host organism:Mus musculus antibody name:6H4

Immunological characterization of abnormal prion protein from atypical scrapie cases in sheep using a panel of monoclonal antibodies.

ID: 1370408

Description: epitope description:YQRESQAYYQRGAS antigen name:Major prion protein host organism:Rattus norvegicus antibody name:R145

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370442

Description: epitope description:YISPYFINTS antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Mus musculus BALB/c antibody name:...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370448

Description: epitope description:RFDKGYISGY antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:CRP-8

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370473

Description: epitope description:TVLARSIAKE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370475

Description: epitope description:EIIEQLDVTT antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370477

Description: epitope description:AVTMGPKGRT antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370479

Description: epitope description:SWGSPKVTKD antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370496

Description: epitope description:YVLLSEKKIS antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370498

Description: epitope description:SIQSIVPALE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370505

Description: epitope description:LKVGGTSDVE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370514

Description: epitope description:EVGYDAMAGD antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370516

Description: epitope description:ASLLTTAEVV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370517

Description: epitope description:TAEVVVTEIP antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370528

Description: epitope description:NRKNQLKDMA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370554

Description: epitope description:ATISANGDKE antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370558

Description: epitope description:IIEGMKFDRG antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370560

Description: epitope description:KGQKCEFQDA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370568

Description: epitope description:GCALLRCIPA antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370569

Description: epitope description:RCIPALDSLT antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

ID: 1370571

Description: epitope description:AKNAGVEGSL antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New Zealand ...

Common peptide epitope in mumps virus nucleocapsid protein and MHC class II-associated invariant chain.

ID: 1370596

Description: epitope description:YQQQGRL antigen name:Mumps rubulavirus protein host organism:Homo sapiens

A synthetic peptide-based polyoxime vaccine construct of high purity and activity.

ID: 1370632

Description: epitope description:PKYVKQNTLKLATGMRNVPEKQT antigen name:Hemagglutinin host organism:Mus musculus antibody name:1/1

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370738

Description: epitope description:YESNHLIDLSRYASKINIG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370743

Description: epitope description:KNQIQLFNLESSKIEVILK antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370753

Description: epitope description:GEIIWTLQDTQEIKQRVVF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370756

Description: epitope description:DYINRWIFVTITNNRLNNS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370761

Description: epitope description:DQKPISNLGNIHASNNIMF antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370768

Description: epitope description:NSGILKDFWGDYLQYDKPY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370773

Description: epitope description:KYVDVNNVGIRGYMYLKGP antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370774

Description: epitope description:YLKGPRGSVMTTNIYLNSS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370775

Description: epitope description:YLKGPRGSVMTTNIYLNSS antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370778

Description: epitope description:KKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370779

Description: epitope description:KKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

Determination of the fine epitope specificity of an anti-hepatitis B virus X protein monoclonal antibody using microanalytical and molecular biologica...

ID: 1356922

Description: epitope description:DRNIYLVRQ host organism:Mus musculus antibody name:3F6-G10

A new form of particulate single and multiple immunogen delivery system based on recombinant bluetongue virus-derived tubules.

ID: 1361307

Description: epitope description:ATGWQTIDGKKYYFNTNTAEAATGWQTIDGKKYYFNTNTAIAST antigen name:Toxin A host organism:Oryctolagus cuniculus

Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

ID: 1361355

Description: epitope description:ALANVYDLPDDFFP antigen name:Capsid protein host organism:Anas platyrhynchos

Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

ID: 1361362

Description: epitope description:KIDDLVRDAKDALE antigen name:Capsid protein host organism:Anas platyrhynchos

Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

ID: 1361371

Description: epitope description:IKKHVLIATHFVDL antigen name:Capsid protein host organism:Anas platyrhynchos

Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

ID: 1361372

Description: epitope description:ATHFVDLIEDFWQT antigen name:Capsid protein host organism:Anas platyrhynchos

Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

ID: 1361373

Description: epitope description:ATHFVDLIEDFWQT antigen name:Capsid protein host organism:Anas platyrhynchos

Identification of antigenic regions of duck hepatitis B virus core protein with antibodies elicited by DNA immunization and chronic infection.

ID: 1361377

Description: epitope description:IEDFWQTTQGMHEI antigen name:Capsid protein host organism:Anas platyrhynchos