Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "
  1. Production and characterization of human monoclonal antibody recognizing the N-terminal residues of Pseudomonas aeruginosa exotoxin A.

    ID: 1422120

    Description: epitope description:AEEAFDLWNECAKACV antigen name:Exotoxin A host organism:Homo sapiens antibody name:FK-001

    Publication: 1651902;
  2. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422380

    Description: epitope description:REFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Mus musculus antibody name:F3, AK13A2 ...

    Publication: 7506298;
  3. Mapping of the antibody and T cell recognition profiles of the HN domain (residues 449-859) of the heavy chain of botulinum neurotoxin A in two high-r...

    ID: 1422413

    Description: epitope description:AVTLAHELIHAGHR antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15921155;
  4. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1422417

    Description: epitope description:RRRFGARAMV antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;
  5. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1422420

    Description: epitope description:PDCAICWEPSPPWAPE antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;

Displaying 5 of 1,510,353 results for " "