Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542360

    Description: epitope description:GTDSGWGNRQSF antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6; 2-2-P15; 18...

    Publication: 7551027;

  2. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542361

    Description: epitope description:FGKLRVGRLNSV antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6; 2-2-P15; 18...

    Publication: 7551027;

  3. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542364

    Description: epitope description:PEFAGLSGSVQY antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6; 2-2-P15; 18...

    Publication: 7551027;

  4. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542365

    Description: epitope description:GRHNSESYHAGF antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6; 2-2-P15; 18...

    Publication: 7551027;

  5. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542367

    Description: epitope description:FFVQYGGAYKRH antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6; 2-2-P15; 18...

    Publication: 7551027;

  6. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1542369

    Description: epitope description:LNIEKYQIHRLV antigen name:Major outer membrane protein P.IB host organism:Mus musculus BALB/c antibody name:MN15A14H6

    Publication: 7551027;

  7. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542437

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  8. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542439

    Description: epitope description:SKLLTLVQLTLQSTNYTCIVCID antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  9. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542445

    Description: epitope description:LALPAPHLTLPFNWTHCFDPQIQ antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  10. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542465

    Description: epitope description:GDYSPSCCTLTIGVSSYHSKP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  11. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542466

    Description: epitope description:SYHSKPCNPAQPVCSWTLDLLAL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  12. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542470

    Description: epitope description:TKKPNRNGGGYYSASYSDPCSL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  13. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542471

    Description: epitope description:SYSDPCSLKCPYLGCQSWTCPYT antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  14. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542472

    Description: epitope description:PCSLKCPYLGCQSWTCPYTGAVS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  15. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542491

    Description: epitope description:NSLILPPFSLSPVPTLGSRSRRA antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  16. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542492

    Description: epitope description:RSRRAVPVAVWLVSALAMGAGVA antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  17. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542494

    Description: epitope description:SLLHEVDKDISQLTQAIVKNHKN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  18. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542497

    Description: epitope description:KNHKNLLKIAQYAAQNRRGLDLL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  19. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542499

    Description: epitope description:GLDLLFWEQGGLCKALQEQCRFPN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  20. Identification of novel neutralization-inducing regions of the human T cell lymphotropic virus type I envelope glycoproteins with human HTLV-I-seropos...

    ID: 1542504

    Description: epitope description:SQWAREALQTGITLVALLLLVIL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 8198868;

  21. Investigation of synthetic Escherichia coli heat-stable enterotoxin as an immunogen for swine and cattle.

    ID: 1542520

    Description: epitope description:CCELCCNPACAGCY antigen name:Heat-stable enterotoxin ST-IA/ST-P host organism:Bos taurus

    Publication: 3552985;

  22. Investigation of synthetic Escherichia coli heat-stable enterotoxin as an immunogen for swine and cattle.

    ID: 1542541

    Description: epitope description:NTFYCCELCCNPACAGCY antigen name:Heat-stable enterotoxin ST-IA/ST-P host organism:Sus scrofa

    Publication: 3552985;

  23. Neutralizing antibodies to human rhinovirus produced in laboratory animals and humans that recognize a linear sequence from VP2.

    ID: 1542570

    Description: epitope description:TRLNPD antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:8F5

    Publication: 1703215;

  24. Neutralizing antibodies to human rhinovirus produced in laboratory animals and humans that recognize a linear sequence from VP2.

    ID: 1548521

    Description: epitope description:VKAETRLNPDLQPTE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1703215;

  25. Analysis of T and B cell epitopes of the Schistosoma mansoni P28 antigen in the rat model by using synthetic peptides.

    ID: 1548522

    Description: epitope description:LVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Rattus norvegicus Fischer 344

    Publication: 2457624;

  26. Neutralizing antibodies to human rhinovirus produced in laboratory animals and humans that recognize a linear sequence from VP2.

    ID: 1548523

    Description: epitope description:VKAETRLNPDLQPTE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1703215;

  27. Neutralizing antibodies to human rhinovirus produced in laboratory animals and humans that recognize a linear sequence from VP2.

    ID: 1548529

    Description: epitope description:VKAETRLNPDLQPTE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1703215;

  28. Neutralizing antibodies to human rhinovirus produced in laboratory animals and humans that recognize a linear sequence from VP2.

    ID: 1548533

    Description: epitope description:VKAETRLNPDLQPTE antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 1703215;

  29. Analysis of T and B cell epitopes of the Schistosoma mansoni P28 antigen in the rat model by using synthetic peptides.

    ID: 1548544

    Description: epitope description:VDYEDERISFQDWPKIKPTIPGGRL antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Rattus norvegicus Fischer 3...

    Publication: 2457624;

  30. Identification of residues in VP2 that contribute to poliovirus neutralization antigenic site 3B.

    ID: 1548555

    Description: epitope description:T141, E143, S312, E315, P417 antigen name:Genome polyprotein host organism:Mus musculus antibody name:10, 13, 15

    Publication: 1714663;

  31. Kinetics of antigen-antibody interactions employing a MALDI mass spectrometry immunoassay.

    ID: 1548560

    Description: epitope description:AYSNCYPYDVPDYASLR + METH(C5) antigen name:Hemagglutinin host organism:Mus musculus SJL antibody name:12/5

    Publication: 18816071;

  32. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548564

    Description: epitope description:AGEVRIGEINNGIQVGAKYDANDIVA antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  33. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548565

    Description: epitope description:DIVAKIAYGRTNYKYNESDEHKQQLNG antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  34. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548566

    Description: epitope description:DIVAKIAYGRTNYKYNESDEHKQQLNG antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  35. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548569

    Description: epitope description:YELMEDTNVYGNFKYERTSVDQGEKTR antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  36. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548576

    Description: epitope description:ARTRTTETGKGVKTEKEKSVGVGLRVYF antigen name:Outer membrane protein P2 host organism:Oryctolagus cuniculus

    Publication: 8500904;

  37. Defining antibody targets in Streptococcus oralis infection.

    ID: 1548584

    Description: epitope description:SWYGAG antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

    Publication: 8613367;

  38. Defining antibody targets in Streptococcus oralis infection.

    ID: 1548585

    Description: epitope description:GKIRAV antigen name:Cell wall surface anchor family protein host organism:Homo sapiens

    Publication: 8613367;

  39. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548593

    Description: epitope description:GANYLLAQKREGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus C57BL/6 antibody name:anti-P2

    Publication: 8500904;

  40. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548594

    Description: epitope description:DIVAKIAYGRTNYKYNESDEHKQQLNG antigen name:Outer membrane protein P2 host organism:Mus musculus C57BL/6 antibody name:anti-P2

    Publication: 8500904;

  41. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548602

    Description: epitope description:VDNQKQQHGALRNQGSRFHIKATHNFGD antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:anti-P2

    Publication: 8500904;

  42. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548603

    Description: epitope description:FGDITSKYAYVTLGNKAFGEVKLGRAKT antigen name:Outer membrane protein P2 host organism:Mus musculus C3H antibody name:anti-P2

    Publication: 8500904;

  43. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548606

    Description: epitope description:GRAKTIADGITSAEDKEYGVLNNSDYIP antigen name:Outer membrane protein P2 host organism:Mus musculus C57BL/6 antibody name:anti-P2

    Publication: 8500904;

  44. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548608

    Description: epitope description:SDYIPTSGNTVGYTFKGIDGLVLGAN antigen name:Outer membrane protein P2 host organism:Mus musculus C57BL/6 antibody name:anti-P2

    Publication: 8500904;

  45. Immunogenicity of overlapping synthetic peptides covering the entire sequence of Haemophilus influenzae type b outer membrane protein P2.

    ID: 1548609

    Description: epitope description:AGEVRIGEINNGIQVGAKYDANDIVA antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:anti-P2

    Publication: 8500904;

  46. Identification of linear B-cell determinants of pertussis toxin associated with the receptor recognition site of the S3 subunit.

    ID: 1548741

    Description: epitope description:TQQGGAYGRCPNGTRA antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 1706321;

  47. Identification of linear B-cell determinants of pertussis toxin associated with the receptor recognition site of the S3 subunit.

    ID: 1548756

    Description: epitope description:GQPAADHYYSKVT antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 1706321;

  48. Immunological detection of penicillin-binding protein 2' of methicillin-resistant staphylococci by using monoclonal antibodies prepared from synthetic...

    ID: 1548765

    Description: epitope description:YNKLTEDKKEPLLNKFQITTSPGSTQKILTA antigen name:UniProt:A7WWU8 host organism:Mus musculus BALB/c

    Publication: 7494059;

  49. Immunological detection of penicillin-binding protein 2' of methicillin-resistant staphylococci by using monoclonal antibodies prepared from synthetic...

    ID: 1548766

    Description: epitope description:IGLNNKTLDDKTSYKIDGKGWQKDKSWGGY antigen name:UniProt:A7WWU8 host organism:Mus musculus BALB/c

    Publication: 7494059;

  50. Epitope-specific protective immunogenicity of chemically synthesized 13-, 18-, and 23-residue peptide fragments of streptococcal M protein.

    ID: 1548767

    Description: epitope description:RKADLEKALEGAM antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6425829;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston