Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467869

    Description: epitope description:PQQSFPQQQQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Mus musculus BALB/c antibody name:5C7, 8D4

    Publication: 17335223;

  2. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467889

    Description: epitope description:PQQPFPQPQQ antigen name:Secale cereale (rye) protein host organism:Mus musculus BALB/c antibody name:5C7

    Publication: 17335223;

  3. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467890

    Description: epitope description:PIQPQQPFPQ antigen name:Secale cereale (rye) protein host organism:Mus musculus BALB/c antibody name:5C7

    Publication: 17335223;

  4. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467902

    Description: epitope description:QQPFPQPQQQ antigen name:Secale cereale (rye) protein host organism:Mus musculus BALB/c antibody name:5C7, 6H5, 8D4

    Publication: 17335223;

  5. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467903

    Description: epitope description:QQPFPQPQQQ antigen name:Secale cereale (rye) protein host organism:Mus musculus BALB/c antibody name:5C7, 6H5, 8D4

    Publication: 17335223;

  6. Specificity analysis of anti-gliadin mouse monoclonal antibodies used for detection of gliadin in food for gluten-free diet.

    ID: 1467905

    Description: epitope description:PFPQPQQQLP antigen name:Secale cereale (rye) protein host organism:Mus musculus BALB/c antibody name:8D4

    Publication: 17335223;

  7. Immunization against foot-and-mouth disease with synthetic peptides representing the C-terminal region of VP1.

    ID: 1464660

    Description: epitope description:VPNLRGDLQVLAQKVART antigen name:Polyprotein host organism:Bos taurus

    Publication: 2457649;

  8. A monoclonal antibody recognizing the 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) trisaccharide alphaKdo(2-->4)alphaKdo(2-->4)alphaKdo of Chlamydophila ...

    ID: 1464665

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:A2...

    Publication: 11521056;

  9. A monoclonal antibody recognizing the 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) trisaccharide alphaKdo(2-->4)alphaKdo(2-->4)alphaKdo of Chlamydophila ...

    ID: 1464667

    Description: epitope description:alpha-D-Kdo-(2->4)-alpha-D-Kdo-(2->4)-alpha-D-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:...

    Publication: 11521056;

  10. A monoclonal antibody recognizing the 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) trisaccharide alphaKdo(2-->4)alphaKdo(2-->4)alphaKdo of Chlamydophila ...

    ID: 1464672

    Description: epitope description:alpha-Kdo-(2->8)-alpha-Kdo-(2->4)-alpha-Kdo antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:S25-23

    Publication: 11521056;

  11. A monoclonal antibody recognizing the 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) trisaccharide alphaKdo(2-->4)alphaKdo(2-->4)alphaKdo of Chlamydophila ...

    ID: 1464676

    Description: epitope description:3-deoxy-alpha-D-manno-oct-2-ulopyranosonic acid antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody name:A2...

    Publication: 11521056;

  12. Identification of P1 gene domain containing epitope(s) mediating Mycoplasma pneumoniae cytoadherence.

    ID: 1464686

    Description: epitope description:NTNTGNDVVGVGRLSESNAAKMNDDVDGIVRTPLAELLDG antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 2450165;

  13. A L.E.A.P.S. heteroconjugate vaccine containing a T cell epitope from HSV-1 glycoprotein D elicits Th1 responses and protection.

    ID: 1464692

    Description: epitope description:SLKMADPNRFRGKDLP antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c

    Publication: 14505924;

  14. Coeliac disease: characterisation of monoclonal antibodies raised against a synthetic peptide corresponding to amino acid residues 206-217 of A-gliadi...

    ID: 1464719

    Description: epitope description:LGQGSFRPSQQN antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus BALB/c antibody ...

    Publication: 1280610;

  15. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464907

    Description: epitope description:SLSTNLDVTNSIEHQ antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  16. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464913

    Description: epitope description:YCADVAAEELMNALV antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  17. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464926

    Description: epitope description:SGKGVSFQLVKLGVW antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  18. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464930

    Description: epitope description:SHRGVIADNQAKWAV antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  19. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464932

    Description: epitope description:DDKLRMETCFQQACK antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  20. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464944

    Description: epitope description:FNVPIKEAGEDCHAP antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  21. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464949

    Description: epitope description:RVEHAVVYYVYSPSR antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  22. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464958

    Description: epitope description:KFLNPDREYDFRDLT antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  23. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464968

    Description: epitope description:ELKLAALCHGEDSIT antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  24. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464975

    Description: epitope description:YCADVAAEELMNALV antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  25. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464980

    Description: epitope description:ALGVINTLEWIPRFK antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  26. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464983

    Description: epitope description:YPFRLPIKGVPIELQ antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  27. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1464996

    Description: epitope description:MNALVNSTLLETRTT antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  28. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465005

    Description: epitope description:EDSITIPYQGSGKGV antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  29. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465006

    Description: epitope description:SHRGVIADNQAKWAV antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  30. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465010

    Description: epitope description:PLITHGSGMDLYKSN antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  31. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465012

    Description: epitope description:EVDGDVKLSSNLVIL antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  32. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465013

    Description: epitope description:SLSTNLDVTNSIEHQ antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  33. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465015

    Description: epitope description:DLVKFISDKIKFLNP antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  34. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465019

    Description: epitope description:LCENPEWAPLKDNRI antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  35. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465020

    Description: epitope description:LKIKIASGFGPLITH antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  36. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465021

    Description: epitope description:PLITHGSGMDLYKSN antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  37. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465030

    Description: epitope description:LSLLDLYLGRGYNVS antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  38. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465040

    Description: epitope description:LSVDLSLTVELKIKI antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  39. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465044

    Description: epitope description:DCHAPTYLPAEVDGD antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 7518172;

  40. Identification of antigenic regions of the Erns protein for pig antibodies elicited during classical swine fever virus infection.

    ID: 1465048

    Description: epitope description:ECAVTCRYDKDADVNVVTQARNRPTTLTGCKKGKNFS antigen name:Genome polyprotein host organism:Sus scrofa antibody name:CSFV antisera

    Publication: 15671490;

  41. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465055

    Description: epitope description:DLVKFISDKIKFLNP antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  42. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465058

    Description: epitope description:AKWAVPTTRTDDKLR antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  43. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465061

    Description: epitope description:LCENPEWAPLKDNRI antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  44. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465063

    Description: epitope description:PLITHGSGMDLYKSN antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  45. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465064

    Description: epitope description:FNVPIKEAGEDCHAP antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  46. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465066

    Description: epitope description:YSPSRSFSYFYPFRL antigen name:Hemagglutinin glycoprotein host organism:Mus musculus TO antibody name:mouse serum

    Publication: 7518172;

  47. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465068

    Description: epitope description:LIGLLAIAGIRLHRAAIYTAEIHK antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  48. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465084

    Description: epitope description:TSQGMYGGTYLVEKP antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  49. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465089

    Description: epitope description:TNYLEQPVSNDLSNC antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  50. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465090

    Description: epitope description:DLSNCMVALGELKLA antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  51. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465092

    Description: epitope description:EDSITIPYQGSGKGV antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  52. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465099

    Description: epitope description:DDKLRMETCFQQACK antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  53. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465110

    Description: epitope description:FNVPIKEAGEDCHAP antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  54. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465119

    Description: epitope description:WDQKLWCRHFCVLAD antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  55. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465120

    Description: epitope description:CVLADSESGGHITHS antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  56. Analysis of the antigenic profile of measles virus haemagglutinin in mice and humans using overlapping synthetic peptides.

    ID: 1465122

    Description: epitope description:GVSCTVTREDGTNRR antigen name:Hemagglutinin glycoprotein host organism:Homo sapiens antibody name:human serum

    Publication: 7518172;

  57. Diagnostic value of a synthetic peptide derived from Echinococcus granulosus recombinant protein.

    ID: 1465131

    Description: epitope description:EFIRKYDKGNKGKINLEELTAMLDSVHRKTSRASMSR antigen name:Calcium-binding protein host organism:Mus musculus BALB/c antibody name:EG 02 1...

    Publication: 1737836;

  58. Functional selection of vaccine candidate peptides from Staphylococcus aureus whole-genome expression libraries in vitro.

    ID: 1465135

    Description: epitope description:KFNPDLAPG antigen name:Surface protein G host organism:Homo sapiens

    Publication: 12874343;

  59. Diagnostic value of a synthetic peptide derived from Echinococcus granulosus recombinant protein.

    ID: 1465165

    Description: epitope description:EAQKAKTKLEEVRLDLDSDKTKLKNAKTAEQKAK antigen name:Hydatid disease diagnostic antigen P-29 host organism:Homo sapiens

    Publication: 1737836;

  60. Diagnostic value of a synthetic peptide derived from Echinococcus granulosus recombinant protein.

    ID: 1465205

    Description: epitope description:EAQKAKTKLEEVRLDLDSDKTKLKNAKTAEQKAK antigen name:Hydatid disease diagnostic antigen P-29 host organism:Homo sapiens

    Publication: 1737836;

  61. Diagnostic value of a synthetic peptide derived from Echinococcus granulosus recombinant protein.

    ID: 1465221

    Description: epitope description:EAQKAKTKLEEVRLDLDSDKTKLKNAKTAEQKAK antigen name:Hydatid disease diagnostic antigen P-29 host organism:Homo sapiens

    Publication: 1737836;

  62. Peptide mimotopes displayed by phage inhibit antibody binding to bet v 1, the major birch pollen allergen, and induce specific IgG response in mice.

    ID: 1465347

    Description: epitope description:CFPYCYPSESA host organism:Mus musculus BALB/c antibody name:BIP1

    Publication: 9837853;

  63. Peptide mimotopes displayed by phage inhibit antibody binding to bet v 1, the major birch pollen allergen, and induce specific IgG response in mice.

    ID: 1465380

    Description: epitope description:CRQTRTMPGC host organism:Mus musculus BALB/c antibody name:BIP4

    Publication: 9837853;

  64. Localization of the continuous allergenic sites of ragweed allergen Ra3 by a comprehensive synthetic strategy.

    ID: 1465447

    Description: epitope description:RAYALWSARQQFKTT antigen name:Amb a 3 host organism:Mus musculus antibody name:anti-Ra3 (21-35)

    Publication: 2410296;

  65. Localization of the continuous allergenic sites of ragweed allergen Ra3 by a comprehensive synthetic strategy.

    ID: 1465449

    Description: epitope description:QFKTTDVLWFNFTTG antigen name:Amb a 3 host organism:Mus musculus antibody name:anti-Ra3 (31-45)

    Publication: 2410296;

  66. Induction of CD4+, human T lymphotropic virus type-1-specific cytotoxic T lymphocytes from patients with HAM/TSP. Recognition of an immunogenic region...

    ID: 1465530

    Description: epitope description:VSSYHSKPCNPAQPV antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1704032;

  67. Identification of the amino acid residues in trichosanthin crucial for IgE response.

    ID: 1465532

    Description: epitope description:QQIGKR antigen name:Ribosome-inactivating protein alpha-trichosanthin host organism:Mus musculus antibody name:TE1

    Publication: 12270124;

  68. Induction of CD4+, human T lymphotropic virus type-1-specific cytotoxic T lymphocytes from patients with HAM/TSP. Recognition of an immunogenic region...

    ID: 1465534

    Description: epitope description:SSPYWKFQHDVNFTQEVSRLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1704032;

  69. Induction of CD4+, human T lymphotropic virus type-1-specific cytotoxic T lymphocytes from patients with HAM/TSP. Recognition of an immunogenic region...

    ID: 1465546

    Description: epitope description:LPFNWTHCFDPQ antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1704032;

  70. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465616

    Description: epitope description:LGGWKLQSDPRAYAL antigen name:Amb a 3 host organism:Mus musculus Outbred antibody name:anti-Ra3

    Publication: 2420608;

  71. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465617

    Description: epitope description:LGGWKLQSDPRAYAL antigen name:Amb a 3 host organism:Homo sapiens antibody name:human sera

    Publication: 2420608;

  72. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465619

    Description: epitope description:RAYALWSARQQFKTT antigen name:Amb a 3 host organism:Mus musculus Outbred antibody name:anti-Ra3

    Publication: 2420608;

  73. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465621

    Description: epitope description:QFKTTDVLWFNFTTG antigen name:Amb a 3 host organism:Mus musculus Outbred antibody name:anti-Ra3

    Publication: 2420608;

  74. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465622

    Description: epitope description:QFKTTDVLWFNFTTG antigen name:Amb a 3 host organism:Oryctolagus cuniculus antibody name:anti-Ra3

    Publication: 2420608;

  75. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465634

    Description: epitope description:PGGPDRFTLLTPGSH antigen name:Amb a 3 host organism:Homo sapiens antibody name:human sera

    Publication: 2420608;

  76. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465635

    Description: epitope description:PGGPDRFTLLTPGSH antigen name:Amb a 3 host organism:Oryctolagus cuniculus antibody name:anti-Ra3

    Publication: 2420608;

  77. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465636

    Description: epitope description:TPGSHFIATKDQKFV host organism:Oryctolagus cuniculus antibody name:anti-Ra3

    Publication: 2420608;

  78. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465638

    Description: epitope description:TPGSHFIATKDQKFV host organism:Mus musculus Outbred antibody name:anti-Ra3

    Publication: 2420608;

  79. Antibody recognition of ragweed allergen Ra3: localization of the full profile of the continuous antigenic sites by synthetic overlapping peptides rep...

    ID: 1465639

    Description: epitope description:DQKFVAAVPGR host organism:Homo sapiens antibody name:human sera

    Publication: 2420608;

  80. Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.

    ID: 1465642

    Description: epitope description:SVTFELLFDGTSPLTEEMGDDFGFGLCPYDTSPVV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:b13

    Publication: 7691986;

  81. Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.

    ID: 1465643

    Description: epitope description:SVTFELLFDGTSPLTEEMGDDFGFGLCPYDTSPVVKGKYNTTLLNGSA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:b...

    Publication: 7691986;

  82. Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.

    ID: 1465644

    Description: epitope description:CKEDHRYAISTTNEIGLHGAEGLT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:b6, b1, b5, b8

    Publication: 7691986;

  83. Characterization of rubella virus-specific antibody responses by using a new synthetic peptide-based enzyme-linked immunosorbent assay.

    ID: 1465647

    Description: epitope description:NQQSRWGLGSPNCHGPDWASPVCQRHS antigen name:Structural polyprotein host organism:Homo sapiens

    Publication: 1629342;

  84. Envelope proteins of human T cell leukemia virus type I: characterization by antisera to synthetic peptides and identification of a natural epitope.

    ID: 1465651

    Description: epitope description:QYAAQNRRGLDLL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2428880;

  85. Envelope proteins of human T cell leukemia virus type I: characterization by antisera to synthetic peptides and identification of a natural epitope.

    ID: 1465656

    Description: epitope description:QYAAQNRRGLDLL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2428880;

  86. Detailed mapping of the antigenicity of the surface unit glycoprotein of equine infectious anemia virus by using synthetic peptide strategies.

    ID: 1465658

    Description: epitope description:KEARDQEMN antigen name:envelope polyprotein host organism:Mus musculus BALB/c antibody name:mAb 86

    Publication: 1370556;

  87. Molecular mimicry by Mycoplasma pneumoniae to evade the induction of adherence inhibiting antibodies.

    ID: 1473111

    Description: epitope description:PFNQWPDY antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Acute patient sera

    Publication: 7473675;

  88. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1473224

    Description: epitope description:TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLD antigen name:Der p 1 host organism:Homo sapiens antibody name:patient ser...

    Publication: 1940366;

  89. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1473226

    Description: epitope description:TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLD antigen name:Der p 1 host organism:Oryctolagus cuniculus antibody name:hy...

    Publication: 1940366;

  90. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1473238

    Description: epitope description:LAQPQRYCRHYWTIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWI antigen name:Der p 1 host organism:Oryctolagus cuniculus antibody name:h...

    Publication: 1940366;

  91. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473282

    Description: epitope description:SWCDPA antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  92. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473288

    Description: epitope description:ALTGCR antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  93. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473293

    Description: epitope description:LQCVGS antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  94. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473295

    Description: epitope description:GSQVPE antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  95. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473302

    Description: epitope description:QLADIN antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  96. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473483

    Description: epitope description:DLYGGSIGYFLTDDVELALSY antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  97. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473491

    Description: epitope description:GYGESRPVADN antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  98. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473493

    Description: epitope description:TDSVRNMKNADL antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  99. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473497

    Description: epitope description:EGHTDSVGTDAYNQK antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  100. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473498

    Description: epitope description:DVCSDSDNDGVCDNV antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston