Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. Mapping of B-neutralizing and T-helper cell epitopes on the bovine leukemia virus external glycoprotein gp51.

    ID: 1422421

    Description: epitope description:PDCAICWEPSPPWAPE antigen name:gp60 SU host organism:Oryctolagus cuniculus

    Publication: 7688821;

  2. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422423

    Description: epitope description:REFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 7506298;

  3. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422426

    Description: epitope description:REFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 7506298;

  4. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422431

    Description: epitope description:SELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabb...

    Publication: 7506298;

  5. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422433

    Description: epitope description:SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cunicu...

    Publication: 7506298;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston