Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Adherence of Pseudomonas aeruginosa and Candida albicans to glycosphingolipid (Asialo-GM1) receptors is achieved by a conserved receptor-binding domai...

    ID: 1375702

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Mus musculus BALB/c antibody name:Fm16

    Publication: 7525482;

  2. Immunochemical determinant of Candida parapsilosis.

    ID: 1376149

    Description: epitope description:alpha-D-Manp-(1->2)-alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-D-Manp antigen name:mannan hos...

    Publication: 6192914;

  3. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376336

    Description: epitope description:QSSESSQANL antigen name:Transcription factor-like 5 protein host organism:Homo sapiens antibody name:chagasic sera

    Publication: 11306602;

  4. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376351

    Description: epitope description:LLVPFCNAET antigen name:Transcription factor-like 5 protein host organism:Mus musculus BALB/c antibody name:T. cruzi-infected mous...

    Publication: 11306602;

  5. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376357

    Description: epitope description:TTAFLKYIQE antigen name:Transcription factor-like 5 protein host organism:Mus musculus BALB/c antibody name:T. cruzi-infected mous...

    Publication: 11306602;

  6. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376363

    Description: epitope description:EFESVFCGKT antigen name:Transcription factor-like 5 protein host organism:Mus musculus BALB/c antibody name:T. cruzi-infected mous...

    Publication: 11306602;

  7. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376367

    Description: epitope description:RLKLTRPDSL antigen name:Transcription factor-like 5 protein host organism:Mus musculus BALB/c antibody name:T. cruzi-infected mous...

    Publication: 11306602;

  8. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376369

    Description: epitope description:PDSLVTCPAQ antigen name:Transcription factor-like 5 protein host organism:Homo sapiens antibody name:chagasic sera

    Publication: 11306602;

  9. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376371

    Description: epitope description:CPAQGSLQSS antigen name:Transcription factor-like 5 protein host organism:Homo sapiens antibody name:chagasic sera

    Publication: 11306602;

  10. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376373

    Description: epitope description:LQSSPSMEIK antigen name:Transcription factor-like 5 protein host organism:Homo sapiens antibody name:chagasic sera

    Publication: 11306602;

  11. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376380

    Description: epitope description:STPSTPADSSAHSTPSTPV antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Homo sapiens antibody name:chagasic sera

    Publication: 11306602;

  12. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376389

    Description: epitope description:IRQLDTSVERRALGEIQNV antigen name:Protein Tcfl5 host organism:Homo sapiens antibody name:chagasic anti-R3 affinity-purified antibod...

    Publication: 11306602;

  13. Fine mapping of antigenic site II of herpes simplex virus glycoprotein D.

    ID: 1376394

    Description: epitope description:DPEDSALL antigen name:Envelope glycoprotein D host organism:Mus musculus antibody name:DL6

    Publication: 2467994;

  14. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376395

    Description: epitope description:MRQLDTNVER antigen name:Transcription factor-like 5 protein host organism:Homo sapiens antibody name:chagasic anti-R3 affinity-pur...

    Publication: 11306602;

  15. Dominant T- and B-cell epitopes in an autoantigen linked to Chagas' disease.

    ID: 1376396

    Description: epitope description:MRQLDTNVER antigen name:Transcription factor-like 5 protein host organism:Homo sapiens antibody name:chagasic anti-R3 affinity-pur...

    Publication: 11306602;

  16. Fine mapping of antigenic site II of herpes simplex virus glycoprotein D.

    ID: 1376399

    Description: epitope description:DDQPSSHQPLFY antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 2467994;

  17. Fine mapping of antigenic site II of herpes simplex virus glycoprotein D.

    ID: 1376403

    Description: epitope description:TQPELVPEDPED antigen name:Envelope glycoprotein D host organism:Mus musculus antibody name:BD78, BD80, BD112, BD135

    Publication: 2467994;

  18. Epitope analysis of glycoprotein I of pseudorabies virus.

    ID: 1376425

    Description: epitope description:DDRRAGFGSA antigen name:envelope glycoprotein E host organism:Mus musculus antibody name:mAbs 1, 3 and 5

    Publication: 1691269;

  19. Fine mapping of antigenic site II of herpes simplex virus glycoprotein D.

    ID: 1376439

    Description: epitope description:KYALADASLKMADPNRFRGKDLP antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 2467994;

  20. Fine mapping of antigenic site II of herpes simplex virus glycoprotein D.

    ID: 1376452

    Description: epitope description:SLPITVYYAVL antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 2467994;

  21. Fine mapping of antigenic site II of herpes simplex virus glycoprotein D.

    ID: 1376456

    Description: epitope description:ERACRSVLLN antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 2467994;

  22. Fine mapping of antigenic site II of herpes simplex virus glycoprotein D.

    ID: 1376467

    Description: epitope description:GFLMHAPAFE antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 2467994;

  23. Fine mapping of antigenic site II of herpes simplex virus glycoprotein D.

    ID: 1376473

    Description: epitope description:QAYQQGVTVD antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 2467994;

  24. Fine mapping of antigenic site II of herpes simplex virus glycoprotein D.

    ID: 1376484

    Description: epitope description:ATPYHPPATP antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 2467994;

  25. Evidence for oligomannosyl residues containing both beta-1,2 and alpha-1,2 linkages as a serotype A-specific epitope(s) in mannans of Candida albicans...

    ID: 1376497

    Description: epitope description:beta-D-Manp-(1->2)-beta-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-D-Manp antigen name:mannan host ...

    Publication: 1373405;

  26. M protein (M1) of influenza virus: antigenic analysis and intracellular localization with monoclonal antibodies.

    ID: 1376510

    Description: epitope description:GTHPSSSAGLKNDLLEN antigen name:Matrix protein 1 host organism:Mus musculus BALB/c antibody name:2E5-C1, 963-D3-G10, and 6B9-B8

    Publication: 2668560;

  27. M protein (M1) of influenza virus: antigenic analysis and intracellular localization with monoclonal antibodies.

    ID: 1376512

    Description: epitope description:ALNGNGDPNNMDKAVKLY antigen name:Matrix protein 1 host organism:Mus musculus BALB/c antibody name:1G11-D11, and 611-G10-D3

    Publication: 2668560;

  28. M protein (M1) of influenza virus: antigenic analysis and intracellular localization with monoclonal antibodies.

    ID: 1376524

    Description: epitope description:ALNGNGDPNNMDKAVKLY antigen name:Matrix protein 1 host organism:Mus musculus BALB/c antibody name:1G11-D11, and 611-G10-D3

    Publication: 2668560;

  29. The immunochemical structure and surface arrangement of Leishmania donovani lipophosphoglycan determined using monoclonal antibodies.

    ID: 1376526

    Description: epitope description:beta-D-Galp6P-(1->4)-alpha-D-Manp antigen name:lipophosphoglycan host organism:Mus musculus BALB/c antibody name:BF9CC, CA7AE

    Publication: 2475775;

  30. Studies on glycoprotein 13 (gp13) of equid herpesvirus 1 using affinity-purified gp13, glycoprotein-specific monoclonal antibodies and synthetic pepti...

    ID: 1376663

    Description: epitope description:PTTNTGEGTSSPVTPTYT antigen name:16 host organism:Mesocricetus auratus DSN

    Publication: 1707948;

  31. Biochemical characterization of Candida albicans epitopes that can elicit protective and nonprotective antibodies.

    ID: 1376668

    Description: epitope description:beta-D-mannopyranosyl-(1->2)-beta-D-mannopyranosyl-(1->2)-beta-D-mannopyranosyl group antigen name:phosphomannan host organism:Mus...

    Publication: 9317014;

  32. Studies on glycoprotein 13 (gp13) of equid herpesvirus 1 using affinity-purified gp13, glycoprotein-specific monoclonal antibodies and synthetic pepti...

    ID: 1376669

    Description: epitope description:PTTNTGEGTSSPVTPTYT antigen name:16 host organism:Mesocricetus auratus DSN

    Publication: 1707948;

  33. Synthetic analogues of beta-1,2 oligomannosides prevent intestinal colonization by the pathogenic yeast Candida albicans.

    ID: 1376675

    Description: epitope description:beta-linked tetramannoside host organism:Mus musculus antibody name:AFI, DF9-3

    Publication: 12435690;

  34. Immunological cross-reactivity between mimicking epitopes on a virus protein and a human autoantigen depends on a single amino acid residue.

    ID: 1376677

    Description: epitope description:PESDQPDL antigen name:Acetylcholine receptor subunit alpha (UniProt:P02708) host organism:Oryctolagus cuniculus

    Publication: 1688524;

  35. Immunological cross-reactivity between mimicking epitopes on a virus protein and a human autoantigen depends on a single amino acid residue.

    ID: 1376678

    Description: epitope description:PESDQPDL antigen name:Acetylcholine receptor subunit alpha (UniProt:P02708) host organism:Oryctolagus cuniculus

    Publication: 1688524;

  36. Studies on glycoprotein 13 (gp13) of equid herpesvirus 1 using affinity-purified gp13, glycoprotein-specific monoclonal antibodies and synthetic pepti...

    ID: 1376689

    Description: epitope description:RSSRPLSEENGEREYN antigen name:16 host organism:Mesocricetus auratus DSN

    Publication: 1707948;

  37. Insight into the PrPC-->PrPSc conversion from the structures of antibody-bound ovine prion scrapie-susceptibility variants.

    ID: 1376705

    Description: epitope description:KQHTVTTTTKGE antigen name:Major prion protein host organism:Mus musculus PrP null antibody name:VRQ14

    Publication: 15240887;

  38. Glycoprotein gp116 of human cytomegalovirus contains epitopes for strain-common and strain-specific antibodies.

    ID: 1376715

    Description: epitope description:ETIYNTTLKY antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:MAb C23

    Publication: 1383409;

  39. Antibody-resistant mutations in cross-reactive and type-specific epitopes of herpes simplex virus 1 glycoprotein B map in separate domains.

    ID: 1376719

    Description: epitope description:APTGDTKPKKNKKPKNP antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:H1392, H1396, H1397

    Publication: 2459843;

  40. Glycoprotein gp116 of human cytomegalovirus contains epitopes for strain-common and strain-specific antibodies.

    ID: 1376729

    Description: epitope description:ETIYNTTLKY antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:MAb C23

    Publication: 1383409;

  41. Glycoprotein gp116 of human cytomegalovirus contains epitopes for strain-common and strain-specific antibodies.

    ID: 1376743

    Description: epitope description:RSVYS antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:CH45, CH86, CH386, CH404, CH408, CH412

    Publication: 1383409;

  42. Glycoprotein gp116 of human cytomegalovirus contains epitopes for strain-common and strain-specific antibodies.

    ID: 1376747

    Description: epitope description:RSVYS antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:MAb CH408

    Publication: 1383409;

  43. Glycoprotein gp116 of human cytomegalovirus contains epitopes for strain-common and strain-specific antibodies.

    ID: 1376754

    Description: epitope description:TSHATSSTHNGSHTSRTTSAQT antigen name:Envelope glycoprotein B host organism:Homo sapiens antibody name:human sera

    Publication: 1383409;

  44. Antibodies against a synthetic peptide identify the Epstein-Barr virus-determined nuclear antigen.

    ID: 1376791

    Description: epitope description:AGAGGGAGGAGAGGGAGGAG antigen name:Epstein-Barr nuclear antigen 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6205400;

  45. Immunological cross-reactivity between mimicking epitopes on a virus protein and a human autoantigen depends on a single amino acid residue.

    ID: 1376809

    Description: epitope description:REDDQPSS antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus

    Publication: 1688524;

  46. Epstein-Barr virus nuclear antigen 1 linear epitopes that are reactive with immunoglobulin A (IgA) or IgG in sera from nasopharyngeal carcinoma patien...

    ID: 1376840

    Description: epitope description:GRPGAPGGSGSGPRHRDGVR antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 1719023;

  47. Induction of polyclonal and monoclonal antibody responses to cholera toxin by the synthetic peptide approach.

    ID: 1371365

    Description: epitope description:HIDSQKKAIERMK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus

    Publication: 3374493;

  48. Domains within the Vibrio cholerae toxin coregulated pilin subunit that mediate bacterial colonization.

    ID: 1371368

    Description: epitope description:MTLLEVIIVLGIMGVVSAGVVTLAQR antigen name:UniProt:A5F392 host organism:Oryctolagus cuniculus

    Publication: 9224877;

  49. Antigenicity of Leishmania braziliensis histone H1 during cutaneous leishmaniasis: localization of antigenic determinants.

    ID: 1371385

    Description: epitope description:MFANSSAAAVTAASNSPQRS antigen name:Putative histone H1 host organism:Homo sapiens

    Publication: 12093677;

  50. Antigenicity of Leishmania braziliensis histone H1 during cutaneous leishmaniasis: localization of antigenic determinants.

    ID: 1371388

    Description: epitope description:MFANSSAAAVTAASNSPQRS antigen name:Putative histone H1 host organism:Homo sapiens

    Publication: 12093677;

  51. Antigenicity of Leishmania braziliensis histone H1 during cutaneous leishmaniasis: localization of antigenic determinants.

    ID: 1371393

    Description: epitope description:KKAAAKKAAAKKAAPKKAAP antigen name:Histone H1 host organism:Homo sapiens

    Publication: 12093677;

  52. Antigenicity of Leishmania braziliensis histone H1 during cutaneous leishmaniasis: localization of antigenic determinants.

    ID: 1371396

    Description: epitope description:APKKAAAKRAAKKSAPKKAV antigen name:Histone H1 host organism:Homo sapiens

    Publication: 12093677;

  53. Antigenicity of Leishmania braziliensis histone H1 during cutaneous leishmaniasis: localization of antigenic determinants.

    ID: 1371398

    Description: epitope description:APKKAVKKAVKAAKKAVKKA antigen name:Putative histone H1 host organism:Homo sapiens

    Publication: 12093677;

  54. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371410

    Description: epitope description:TPHSGEEHAVGNDTGKHGKEIKITPQSSITE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2371772;

  55. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371412

    Description: epitope description:KHSMVDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  56. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371414

    Description: epitope description:CTGKFKIVKEIAETQHGTIVIRVQYEGDGSPC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  57. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1371423

    Description: epitope description:YISGYFVTDP antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:9C9

    Publication: 17301219;

  58. Antibodies against C-reactive protein cross-react with 60-kilodalton heat shock proteins.

    ID: 1371424

    Description: epitope description:RFDKGYISGY antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:CRP-8

    Publication: 17301219;

  59. The dual-specific binding of dengue virus and target cells for the antibody-dependent enhancement of dengue virus infection.

    ID: 1371427

    Description: epitope description:CPFLKQNEPEDIDCW antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:anti-prM (70-21)

    Publication: 16493039;

  60. Induction of polyclonal and monoclonal antibody responses to cholera toxin by the synthetic peptide approach.

    ID: 1371431

    Description: epitope description:HIDSQKKAIERMK antigen name:Cholera enterotoxin subunit B host organism:Mus musculus BALB/c antibody name:CTBP1-F3<...

    Publication: 3374493;

  61. The dual-specific binding of dengue virus and target cells for the antibody-dependent enhancement of dengue virus infection.

    ID: 1371433

    Description: epitope description:CPFLKQNEPEDIDCW antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:anti-prM (70-21)

    Publication: 16493039;

  62. Induction of polyclonal and monoclonal antibody responses to cholera toxin by the synthetic peptide approach.

    ID: 1371434

    Description: epitope description:HIDSQKKAIERMK antigen name:Cholera enterotoxin subunit B host organism:Oryctolagus cuniculus

    Publication: 3374493;

  63. Mapping of the antigenic determinants of the Leishmania infantum gp63 protein recognized by antibodies elicited during canine visceral leishmaniasis.

    ID: 1371935

    Description: epitope description:ASSAAEFLAAFNVFSEAARC antigen name:GP63, leishmanolysin host organism:Canis lupus familiaris

    Publication: 9172421;

  64. Mapping of the antigenic determinants of the Leishmania infantum gp63 protein recognized by antibodies elicited during canine visceral leishmaniasis.

    ID: 1371936

    Description: epitope description:EAARCIDGAFTPKNRTAADG antigen name:GP63, leishmanolysin host organism:Canis lupus familiaris

    Publication: 9172421;

  65. Mapping of the antigenic determinants of the Leishmania infantum gp63 protein recognized by antibodies elicited during canine visceral leishmaniasis.

    ID: 1371940

    Description: epitope description:TVSNAFEEGGCITCPPYVEV antigen name:GP63, leishmanolysin host organism:Canis lupus familiaris

    Publication: 9172421;

  66. Identification of naturally occurring monoclonal antibody escape variants of louping ill virus.

    ID: 1371946

    Description: epitope description:D308 antigen name:Genome polyprotein host organism:Mus musculus antibody name:4.2 and 7.1

    Publication: 8126456;

  67. The humoral immune response to the kinetoplastid membrane protein-11 in patients with American leishmaniasis and Chagas disease: prevalence of IgG sub...

    ID: 1371947

    Description: epitope description:GEEFNRKMQEQNAKFFADKP antigen name:Kinetoplastid membrane protein-11 host organism:Homo sapiens

    Publication: 10656675;

  68. The humoral immune response to the kinetoplastid membrane protein-11 in patients with American leishmaniasis and Chagas disease: prevalence of IgG sub...

    ID: 1371952

    Description: epitope description:EHYEKFERMIKEHTEKFNKK antigen name:Kinetoplastid membrane protein-11 host organism:Homo sapiens

    Publication: 10656675;

  69. The humoral immune response to the kinetoplastid membrane protein-11 in patients with American leishmaniasis and Chagas disease: prevalence of IgG sub...

    ID: 1371953

    Description: epitope description:EHYEKFERMIKEHTEKFNKK antigen name:Kinetoplastid membrane protein-11 host organism:Canis lupus familiaris

    Publication: 10656675;

  70. Antigenicity of the Leishmania infantum histones H2B and H4 during canine viscerocutaneous leishmaniasis.

    ID: 1371973

    Description: epitope description:ANKKRTLGAREVQTAVRIVL antigen name:Histone H2B host organism:Canis lupus familiaris antibody name:Dog Sera

    Publication: 9933463;

  71. Antigenicity of the Leishmania infantum histones H2B and H4 during canine viscerocutaneous leishmaniasis.

    ID: 1371984

    Description: epitope description:TACDVVTALRKQGHILYGYA antigen name:Histone H4 host organism:Canis lupus familiaris antibody name:Dog Sera

    Publication: 9933463;

  72. Mapping of the linear antigenic determinants from the Leishmania infantum histone H2A recognized by sera from dogs with leishmaniasis.

    ID: 1371989

    Description: epitope description:KGGKKGKATPSA antigen name:Histone H2A host organism:Canis lupus familiaris

    Publication: 8867853;

  73. Mapping of the linear antigenic determinants from the Leishmania infantum histone H2A recognized by sera from dogs with leishmaniasis.

    ID: 1371990

    Description: epitope description:ISKAMAKKKGGKKGKATPSA antigen name:Histone H2A host organism:Canis lupus familiaris

    Publication: 8867853;

  74. Mapping of the linear antigenic determinants from the Leishmania infantum histone H2A recognized by sera from dogs with leishmaniasis.

    ID: 1371995

    Description: epitope description:KRCRLNPRTVMLAARHDDDI antigen name:Histone H2A host organism:Canis lupus familiaris

    Publication: 8867853;

  75. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 1372049

    Description: epitope description:MTEQQWNFAGIEAAAS antigen name:6 kDa early secretory antigenic target host organism:Homo sapiens antibody name:Human sera

    Publication: 15325505;

  76. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 1372080

    Description: epitope description:DQVHFQPLPPAVVKLSDALI antigen name:Phosphate-binding protein PstS 1 host organism:Homo sapiens

    Publication: 15325505;

  77. Generation and characterization of monoclonal antibodies against dengue virus type 1 for epitope mapping and serological detection by epitope-based pe...

    ID: 1372120

    Description: epitope description:DPLTSLHAMQRR host organism:Homo sapiens

    Publication: 17287314;

  78. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372138

    Description: epitope description:MPSITTAKREYEERLVDCLT antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  79. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372141

    Description: epitope description:MANSSLLRVVLVALLLLGSV antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  80. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372148

    Description: epitope description:TSVLDAHRVKRAARVGAISP antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  81. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372150

    Description: epitope description:GMEPTQTSFFQALNIATKIA antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  82. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372152

    Description: epitope description:KVLSVGDKVDNSTATLLQKL antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  83. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372156

    Description: epitope description:LSNVAAMALGAGIPTSSTIG antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  84. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372162

    Description: epitope description:AAKEEPEESDEDDFGMGGLF antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  85. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372163

    Description: epitope description:PSAAAKEEPEESDEDD antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  86. Identification of the Leishmania infantum P0 ribosomal protein epitope in canine visceral leishmaniasis.

    ID: 1372165

    Description: epitope description:SCSAAAEPAAAAPAAPSAAAKEEPEESDEDDFGMGGLF antigen name:60S acidic ribosomal protein P0 host organism:Canis lupus familiaris

    Publication: 8847086;

  87. Characterizing cellular immune response to kinetoplastid membrane protein-11 (KMP-11) during Leishmania (Viannia) panamensis infection using dendritic...

    ID: 1372210

    Description: epitope description:DEEFNKKMQEQNAKFFADKP antigen name:kinetoplastid membrane protein-11 (GenPept:685207604) host organism:Homo sapiens

    Publication: 12940963;

  88. Characterizing cellular immune response to kinetoplastid membrane protein-11 (KMP-11) during Leishmania (Viannia) panamensis infection using dendritic...

    ID: 1372212

    Description: epitope description:FADKPDESTLSPEMKEHYDK antigen name:kinetoplastid membrane protein-11 (GenPept:685207605) host organism:Homo sapiens

    Publication: 12940963;

  89. Characterizing cellular immune response to kinetoplastid membrane protein-11 (KMP-11) during Leishmania (Viannia) panamensis infection using dendritic...

    ID: 1372214

    Description: epitope description:EHYDKFERMIKEHTEKFNKK antigen name:kinetoplastid membrane protein-11 (GenPept:685207605) host organism:Homo sapiens

    Publication: 12940963;

  90. Characterizing cellular immune response to kinetoplastid membrane protein-11 (KMP-11) during Leishmania (Viannia) panamensis infection using dendritic...

    ID: 1372216

    Description: epitope description:KFNKKMHEHSEHFKHKFAEL antigen name:kinetoplastid membrane protein-11 (GenPept:685207605) host organism:Homo sapiens

    Publication: 12940963;

  91. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372220

    Description: epitope description:TVSAGDGRGTPIAFQAEVSK antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  92. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372226

    Description: epitope description:GVGAGGGDQNNLIGQFGVGF antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  93. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372230

    Description: epitope description:FLSAETIKKTIHQYSEFINF antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  94. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372233

    Description: epitope description:TQGVVKERRWTLVNENRPIW antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  95. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372237

    Description: epitope description:VPNTNIKLYVRRVFITDEFR antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  96. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372240

    Description: epitope description:LVRKTLSMFADIAAQDEAIA antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Canis lupus familiaris

    Publication: 11803053;

  97. Mapping of the linear antigenic determinants of the Leishmania infantum hsp70 recognized by leishmaniasis sera.

    ID: 1372414

    Description: epitope description:PKVQSLVSDFFGGKELNKSI antigen name:Putative heat-shock protein hsp70 host organism:Canis lupus familiaris antibody name:canine sera

    Publication: 8905399;

  98. Mapping of the linear antigenic determinants of the Leishmania infantum hsp70 recognized by leishmaniasis sera.

    ID: 1372418

    Description: epitope description:LESVCNPIMTKMYQSMGGAA antigen name:Putative heat-shock protein hsp70 host organism:Canis lupus familiaris antibody name:canine sera

    Publication: 8905399;

  99. Mapping of the linear antigenic determinants of the Leishmania infantum hsp70 recognized by leishmaniasis sera.

    ID: 1372419

    Description: epitope description:IAYGLDKGDDGKERNVLIFD antigen name:Putative heat-shock protein hsp70 host organism:Canis lupus familiaris antibody name:canine sera

    Publication: 8905399;

  100. Molecular mimicry between the immunodominant ribosomal protein P0 of Trypanosoma cruzi and a functional epitope on the human beta 1-adrenergic recepto...

    ID: 1372453

    Description: epitope description:HWWRAESDEARRCYNDPKCCDFVTNR antigen name:Beta-1 adrenergic receptor host organism:Homo sapiens

    Publication: 7790824;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston