Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Sequences of antigenic epitopes of streptokinase identified via random peptide libraries displayed on phage.

    ID: 1509207

    Description: epitope description:PFWLSD host organism:Mus musculus BALB/c antibody name:9D10

    Publication: 9268662;

  2. Sequences of antigenic epitopes of streptokinase identified via random peptide libraries displayed on phage.

    ID: 1509209

    Description: epitope description:QKSKPF host organism:Mus musculus BALB/c antibody name:10E1

    Publication: 9268662;

  3. Use of immunoreactive synthetic HTLV-1 peptides in the search for antibody reactivity in multiple sclerosis.

    ID: 1509223

    Description: epitope description:LPPTAPPLLPHSNLDHILEPSIPW antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1546533;

  4. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509259

    Description: epitope description:EQSSSTEDNQEQQHGALRNQGS antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8975905;

  5. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509263

    Description: epitope description:QERDLRTLDSRTNPTKSGEVT antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8975905;

  6. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509274

    Description: epitope description:EDKEYGLLNSKKYIPTNGN antigen name:Other Haemophilus influenzae protein host organism:Mus musculus

    Publication: 8975905;

  7. Importance of an immunodominant surface-exposed loop on outer membrane protein P2 of nontypeable Haemophilus influenzae.

    ID: 1509285

    Description: epitope description:TNYKDSNHSYTQKIPKANAADADTDTTIIYPHHGKKQEVNGALASL antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cunicul...

    Publication: 8975905;

  8. Scrapie-associated precursor proteins: antigenic relationship between species and immunocytochemical localization in normal, scrapie, and Creutzfeldt-...

    ID: 1509294

    Description: epitope description:GQGGGTHNQWNKPSK antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 1969126;

  9. Scrapie-associated precursor proteins: antigenic relationship between species and immunocytochemical localization in normal, scrapie, and Creutzfeldt-...

    ID: 1509296

    Description: epitope description:GQGGGTHNQWNKPSK antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Oryctolagus cuniculus New Zealand ...

    Publication: 1969126;

  10. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509299

    Description: epitope description:KTKRNTNRRPQDVKF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  11. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509301

    Description: epitope description:GPRLGVRATRKTSERSQP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  12. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509302

    Description: epitope description:ATRKTSERSQPRGRRQPI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  13. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509310

    Description: epitope description:YPGHVSGHRMAWDMM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  14. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509314

    Description: epitope description:AADMIMHTPGCVPCV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  15. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509315

    Description: epitope description:SRCWVALTPTLAARN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  16. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509316

    Description: epitope description:AARNSSIPTTTIRRHVDL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  17. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509318

    Description: epitope description:SPRRYETVQDCNCSLYPG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  18. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509322

    Description: epitope description:NETDVLLLNNTRPPQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  19. Reactivity of synthetic peptides representing selected sections of hepatitis C virus core and envelope proteins with a panel of hepatitis C virus-sero...

    ID: 1509323

    Description: epitope description:DCFRKHPEATYTKCGSGP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 8986952;

  20. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509337

    Description: epitope description:NCTYFCG antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  21. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509342

    Description: epitope description:CGRNAYC antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  22. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509346

    Description: epitope description:AYCNEEC antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  23. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509352

    Description: epitope description:CTKLKGE antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  24. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509362

    Description: epitope description:CQWASPY antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  25. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509366

    Description: epitope description:SPYGNAC antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  26. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509367

    Description: epitope description:PYGNACY antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  27. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509370

    Description: epitope description:NACYCYK antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  28. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509371

    Description: epitope description:ACYCYKL antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  29. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509375

    Description: epitope description:YKLPDHV antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  30. Fine molecular analysis of the antigenicity of the Androctonus australis hector scorpion neurotoxin II: a new antigenic epitope disclosed by the Pepsc...

    ID: 1509379

    Description: epitope description:PDHVRTK antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 7690110;

  31. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1509398

    Description: epitope description:TPGYKNDALSHFHLT host organism:Mus musculus BALB/c antibody name:C1.3

    Publication: 9281855;

  32. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590091

    Description: epitope description:VQPQVNKEIR antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  33. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590100

    Description: epitope description:AYGIKSNVVR antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  34. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590104

    Description: epitope description:ADTIQKGFYY antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  35. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590109

    Description: epitope description:AGIRPKGAFQ antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  36. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590112

    Description: epitope description:KQMGQTGGSY antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  37. A peptide-based human T cell leukemia virus type I vaccine containing T and B cell epitopes that induces high titers of neutralizing antibodies.

    ID: 1590129

    Description: epitope description:SQLPPTAPPLLPHSNLDHILEPSIPWKSKL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7527817;

  38. A peptide-based human T cell leukemia virus type I vaccine containing T and B cell epitopes that induces high titers of neutralizing antibodies.

    ID: 1590130

    Description: epitope description:SQLPPTAPPLLPHSNLDHILEPSIPWKSKL antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7527817;

  39. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590135

    Description: epitope description:VQPQVNKEIR antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  40. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590139

    Description: epitope description:PQEIRDVLSK antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  41. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590143

    Description: epitope description:NVPKINPKKD antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  42. A peptide-based human T cell leukemia virus type I vaccine containing T and B cell epitopes that induces high titers of neutralizing antibodies.

    ID: 1590151

    Description: epitope description:LPHSNLDHIL antigen name:Envelope glycoprotein gp62 host organism:Rattus norvegicus WKAH

    Publication: 7527817;

  43. Genetic and antigenic variation of capsid protein VP7 of serotype G1 human rotavirus isolates.

    ID: 1590164

    Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV4:3

    Publication: 10073693;

  44. Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

    ID: 1590166

    Description: epitope description:D213 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:KU-4

    Publication: 2452893;

  45. Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

    ID: 1590180

    Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:YO-4C2

    Publication: 2452893;

  46. Cross-reactive and serotype-specific neutralization epitopes on VP7 of human rotavirus: nucleotide sequence analysis of antigenic mutants selected wit...

    ID: 1590192

    Description: epitope description:W98 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus antibody name:YO-4C2

    Publication: 2452893;

  47. Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

    ID: 1590238

    Description: epitope description:IWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKK + MCM(C3, C15, C19, C33) antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 9250594;

  48. Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

    ID: 1590239

    Description: epitope description:ALCSEKLDQWLCEKL + MCM(C3, C12) antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 9250594;

  49. Human IgE binding capacity of tryptic peptides from bovine alpha-lactalbumin.

    ID: 1590249

    Description: epitope description:IWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVK + MCM(C3, C15, C19, C33) antigen name:Bos d 4 host organism:Homo sapiens

    Publication: 9250594;

  50. Mapping of B-cell epitopes on the outer membrane P2 porin protein of Haemophilus influenzae by using recombinant proteins and synthetic peptides.

    ID: 1593073

    Description: epitope description:GANYLLAQKREGAKGENKRPNDKAGEV antigen name:Outer membrane protein P2 host organism:Mus musculus BALB/c antibody name:P2-3

    Publication: 1706322;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston