Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Molecular mimicry between the immunodominant ribosomal protein P0 of Trypanosoma cruzi and a functional epitope on the human beta 1-adrenergic recepto...

    ID: 1372462

    Description: epitope description:AESEE antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 7790824;

  2. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372601

    Description: epitope description:NDQGNRTTPSYVAFTDSERL antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antibody name:patient sera

    Publication: 9840686;

  3. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372604

    Description: epitope description:RKFNDSVVQSDMKHWPFKVT antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antibody name:patient sera

    Publication: 9840686;

  4. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372605

    Description: epitope description:VQYRGEEKTFTPEEISSMVL antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antibody name:patient sera

    Publication: 9840686;

  5. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372631

    Description: epitope description:KNGLENYAYSMKNTLSDSNV antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antibody name:patient sera

    Publication: 9840686;

  6. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372639

    Description: epitope description:VCNPIMTKMYQSMGGAAGGMPGGMPGMSGMSGGAGPAGGASSGPKVEEVD antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antib...

    Publication: 9840686;

  7. Analysis of the antigenic properties of the L. infantum Hsp70: design of synthetic peptides for specific serodiagnosis of human leishmaniasis.

    ID: 1372650

    Description: epitope description:TLSDSNVSGKLEDSDKATLNKEIDVVLEWLSSNQEAAKEEYEHKQKELES antigen name:Putative heat-shock protein hsp70 host organism:Homo sapiens antib...

    Publication: 9840686;

  8. Antibodies to an epitope from the Cha human autoantigen are markers of Chagas' disease.

    ID: 1372298

    Description: epitope description:MRQLDTNVERRALGEIQNV antigen name:Transcription factor-like 5 protein host organism:Homo sapiens

    Publication: 11687436;

  9. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372307

    Description: epitope description:GVGAGGGDQNNLIGQFGVGF antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  10. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372308

    Description: epitope description:YSVFLVGDRVRVASKSDDSD antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  11. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372314

    Description: epitope description:TQGVVKERRWTLVNENRPIW antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  12. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372317

    Description: epitope description:DSILFVPTTVDPASFSDDNS antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  13. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372321

    Description: epitope description:LVRKTLSMFADIAAQDEAIA antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  14. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372327

    Description: epitope description:HDVEVIFMTDAIDEYVVSQL antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Homo sapiens

    Publication: 11803053;

  15. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372339

    Description: epitope description:TVSAGDGRGTPIAFQAEVSK antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  16. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372346

    Description: epitope description:YSVFLVGDRVRVASKSDDSD antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  17. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372353

    Description: epitope description:TRPIGNVTEEEYHTFYKAFS antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  18. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372354

    Description: epitope description:GDYRDPLYFNHFKVEGEVDF antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  19. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372355

    Description: epitope description:DSILFVPTTVDPASFSDDNS antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  20. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372366

    Description: epitope description:TDFAGKKLINLAKEGVQLEE antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  21. Antigenic properties of the Leishmania infantum GRP94 and mapping of linear B-cell epitopes.

    ID: 1372367

    Description: epitope description:SDARQRVADRKRKEKYDSFF antigen name:Putative lipophosphoglycan biosynthetic protein host organism:Mesocricetus auratus HsdHan:Aura

    Publication: 11803053;

  22. Mapping of the linear antigenic determinants of the Leishmania infantum hsp70 recognized by leishmaniasis sera.

    ID: 1372400

    Description: epitope description:LNKSINPDEAVAYGAAVQAF antigen name:Putative heat-shock protein hsp70 host organism:Canis lupus familiaris antibody name:canine sera

    Publication: 8905399;

  23. Mapping of the linear antigenic determinants of the Leishmania infantum hsp70 recognized by leishmaniasis sera.

    ID: 1372401

    Description: epitope description:AVQAFILTGGKSKQTEGLLL antigen name:Putative heat-shock protein hsp70 host organism:Canis lupus familiaris antibody name:canine sera

    Publication: 8905399;

  24. Mapping of the linear antigenic determinants of the Leishmania infantum hsp70 recognized by leishmaniasis sera.

    ID: 1372403

    Description: epitope description:ETAGGVMTALIKRNTTIPTK antigen name:Putative heat-shock protein hsp70 host organism:Canis lupus familiaris antibody name:canine sera

    Publication: 8905399;

  25. Antigenicity and conformational analysis of the Zn(2+)-binding sites of two Zn(2+)-metalloproteases: Leishmania gp63 and mammalian endopeptidase-24.11...

    ID: 1373814

    Description: epitope description:VVTHEMAHALG antigen name:GP63, leishmanolysin (UniProt:Q4QHH2) host organism:Oryctolagus cuniculus New Zealand White antibody name...

    Publication: 8573078;

  26. Antigenicity and conformational analysis of the Zn(2+)-binding sites of two Zn(2+)-metalloproteases: Leishmania gp63 and mammalian endopeptidase-24.11...

    ID: 1373816

    Description: epitope description:VIGHEITHGFD antigen name:Membrane metallo-endopeptidase-like 1 host organism:Oryctolagus cuniculus New Zealand White antibody name...

    Publication: 8573078;

  27. Adherence of Pseudomonas aeruginosa and Candida albicans to glycosphingolipid (Asialo-GM1) receptors is achieved by a conserved receptor-binding domai...

    ID: 1373829

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Mus musculus BALB/c antibody name:Fm16

    Publication: 7525482;

  28. Conformational and epitope mapping of herpes-simplex-virus type-1 thymidine kinase using synthetic peptide segments.

    ID: 1373834

    Description: epitope description:LGSRDDIVYVPEPMT antigen name:Thymidine kinase host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 1716203;

  29. Conformational and epitope mapping of herpes-simplex-virus type-1 thymidine kinase using synthetic peptide segments.

    ID: 1373835

    Description: epitope description:DDIVYVPEPMTYWRV antigen name:Thymidine kinase host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 1716203;

  30. Conformational and epitope mapping of herpes-simplex-virus type-1 thymidine kinase using synthetic peptide segments.

    ID: 1373846

    Description: epitope description:GLLANTVRYLQCGGS antigen name:Thymidine kinase host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 1716203;

  31. Conformational and epitope mapping of herpes-simplex-virus type-1 thymidine kinase using synthetic peptide segments.

    ID: 1373847

    Description: epitope description:WREDWGQLSGTAVPPQ antigen name:Thymidine kinase host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 1716203;

  32. Conformational and epitope mapping of herpes-simplex-virus type-1 thymidine kinase using synthetic peptide segments.

    ID: 1373848

    Description: epitope description:GAEPQSNAGPRPHIG antigen name:Thymidine kinase host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 1716203;

  33. Conformational and epitope mapping of herpes-simplex-virus type-1 thymidine kinase using synthetic peptide segments.

    ID: 1373849

    Description: epitope description:DTLFTLFRAPELLAPNG antigen name:Thymidine kinase host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 1716203;

  34. Conformational and epitope mapping of herpes-simplex-virus type-1 thymidine kinase using synthetic peptide segments.

    ID: 1373852

    Description: epitope description:QSPAGCRDALLQLTS antigen name:Thymidine kinase host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 1716203;

  35. Conformational and epitope mapping of herpes-simplex-virus type-1 thymidine kinase using synthetic peptide segments.

    ID: 1373854

    Description: epitope description:ICDLARTFAREMGEAN antigen name:Thymidine kinase host organism:Oryctolagus cuniculus antibody name:rabbit sera

    Publication: 1716203;

  36. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374379

    Description: epitope description:YPVDRSTFW host organism:Homo sapiens antibody name:patient sera

    Publication: 11179365;

  37. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374381

    Description: epitope description:LASAGGQDN host organism:Oryctolagus cuniculus antibody name:affinity-purified rabbit trans-sialidase (TcTS)

    Publication: 11179365;

  38. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374384

    Description: epitope description:NPIDHSARS host organism:Oryctolagus cuniculus antibody name:affinity-purified rabbit trans-sialidase (TcTS)

    Publication: 11179365;

  39. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374385

    Description: epitope description:NPIDATARS host organism:Oryctolagus cuniculus antibody name:affinity-purified rabbit trans-sialidase (TcTS)

    Publication: 11179365;

  40. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374386

    Description: epitope description:GPPVDPTSG host organism:Oryctolagus cuniculus antibody name:affinity-purified rabbit trans-sialidase (TcTS)

    Publication: 11179365;

  41. Malaria parasite-inhibitory antibody epitopes on Plasmodium falciparum merozoite surface protein-1(19) mapped by TROSY NMR.

    ID: 1373158

    Description: epitope description:H1530, Q1531, C1532, Q1539, N1540, S1541, C1543, H1546, L1547, E1549, R1550, E1551, C1553, L1557, N1558, E1562, K1565, C1566, C160...

    Publication: 15500913;

  42. Crossreactions and sequence homologies between recombinant polypeptides from Leishmania aethiopica and human IgG and IgM.

    ID: 1373277

    Description: epitope description:HRSSGGGL antigen name:Leishmania aethiopica protein host organism:Capra hircus

    Publication: 9012439;

  43. A monoclonal antibody against the immunodominant epitope of the ribosomal P2beta protein of Trypanosoma cruzi interacts with the human beta 1-adrenerg...

    ID: 1373278

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus BALB/c antibody name:17.2

    Publication: 11449375;

  44. A monoclonal antibody against the immunodominant epitope of the ribosomal P2beta protein of Trypanosoma cruzi interacts with the human beta 1-adrenerg...

    ID: 1373279

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus

    Publication: 11449375;

  45. Protective immune responses against systemic candidiasis mediated by phage-displayed specific epitope of Candida albicans heat shock protein 90 in C57...

    ID: 1373421

    Description: epitope description:DEPAGE antigen name:Heat shock protein 90 homolog host organism:Homo sapiens antibody name:human sera

    Publication: 16842891;

  46. Molecular mimicry by Trypanosoma cruzi: the F1-160 epitope that mimics mammalian nerve can be mapped to a 12-amino acid peptide.

    ID: 1373427

    Description: epitope description:ATLTSDEQTVDPEERKDT antigen name:Trans-sialidase, putative (UniProt:K4DMV5) host organism:Oryctolagus cuniculus

    Publication: 1712477;

  47. Retro-inverso peptide analogues of Trypanosoma cruzi B13 protein epitopes fail to be recognized by human sera and peripheral blood mononuclear cells.

    ID: 1373435

    Description: epitope description:PFGQAAAGDKPS host organism:Homo sapiens

    Publication: 11390013;

  48. Antibodies against the carboxyl-terminal end of the Trypanosoma cruzi ribosomal P proteins are pathogenic.

    ID: 1373455

    Description: epitope description:EDDDDDFGMGALF antigen name:60S acidic ribosomal protein P0 host organism:Homo sapiens

    Publication: 11726536;

  49. Mapping of B cell epitopes in an immunodominant antigen of Trypanosoma cruzi using fusions to the Escherichia coli LamB protein.

    ID: 1373590

    Description: epitope description:AEKQKAAEATKVAE antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 9675858;

  50. Mapping of B cell epitopes in an immunodominant antigen of Trypanosoma cruzi using fusions to the Escherichia coli LamB protein.

    ID: 1373601

    Description: epitope description:QKAAEATKVAEAEK antigen name:Other Trypanosoma cruzi protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9675858;

  51. Mapping of B cell epitopes in an immunodominant antigen of Trypanosoma cruzi using fusions to the Escherichia coli LamB protein.

    ID: 1373602

    Description: epitope description:AEATKVAEAEKQKA antigen name:Other Trypanosoma cruzi protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9675858;

  52. Antibodies against the carboxyl-terminal end of the Trypanosoma cruzi ribosomal P proteins are pathogenic.

    ID: 1373609

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus BALB/c

    Publication: 11726536;

  53. Immunohistological analysis of in situ expression of mycobacterial antigens in skin lesions of leprosy patients across the histopathological spectrum....

    ID: 1373687

    Description: epitope description:SYPPP antigen name:Proline rich antigenic protein host organism:Mus musculus BALB/c antibody name:F126-5

    Publication: 10362804;

  54. Selective expression of a stable cell surface molecule on type 2 but not type 1 helper T cells.

    ID: 1373697

    Description: epitope description:GEARIQEEEGRNESSSNDMDC antigen name:Interleukin-1 receptor-like 1 host organism:Oryctolagus cuniculus antibody name:anti-ST2L

    Publication: 9480988;

  55. Major Trypanosoma cruzi antigenic determinant in Chagas' heart disease shares homology with the systemic lupus erythematosus ribosomal P protein epito...

    ID: 1373700

    Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 1696282;

  56. Major Trypanosoma cruzi antigenic determinant in Chagas' heart disease shares homology with the systemic lupus erythematosus ribosomal P protein epito...

    ID: 1373742

    Description: epitope description:DDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 1696282;

  57. Major Trypanosoma cruzi antigenic determinant in Chagas' heart disease shares homology with the systemic lupus erythematosus ribosomal P protein epito...

    ID: 1373763

    Description: epitope description:MGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 1696282;

  58. Leucine rich repeats are the main epitopes in Leishmania infantum PSA during canine and human visceral leishmaniasis.

    ID: 1373767

    Description: epitope description:SGTLPSEWSSMTRLRDLNLHGANI antigen name:Other Leishmania infantum protein host organism:Oryctolagus cuniculus

    Publication: 10652117;

  59. Antigenicity and conformational analysis of the Zn(2+)-binding sites of two Zn(2+)-metalloproteases: Leishmania gp63 and mammalian endopeptidase-24.11...

    ID: 1373780

    Description: epitope description:VVTHEMAHALG antigen name:GP63, leishmanolysin (UniProt:Q4QHH2) host organism:Oryctolagus cuniculus New Zealand White antibody name...

    Publication: 8573078;

  60. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374393

    Description: epitope description:NPIDHSARS host organism:Homo sapiens antibody name:patient sera

    Publication: 11179365;

  61. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374395

    Description: epitope description:STDPAATD host organism:Homo sapiens antibody name:patient sera

    Publication: 11179365;

  62. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374396

    Description: epitope description:PLSLRSK host organism:Homo sapiens antibody name:normal human sera

    Publication: 11179365;

  63. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374400

    Description: epitope description:NPIDHSARS host organism:Mus musculus BALB/c antibody name:anti-B13

    Publication: 11179365;

  64. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374402

    Description: epitope description:PRVRSKPVV host organism:Mus musculus BALB/c antibody name:anti-R23

    Publication: 11179365;

  65. The beta1 adrenergic effects of antibodies against the C-terminal end of the ribosomal P2beta protein of Trypanosoma cruzi associate with a specific p...

    ID: 1374409

    Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Mus musculus

    Publication: 16178868;

  66. The beta1 adrenergic effects of antibodies against the C-terminal end of the ribosomal P2beta protein of Trypanosoma cruzi associate with a specific p...

    ID: 1374410

    Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Mus musculus

    Publication: 16178868;

  67. The beta1 adrenergic effects of antibodies against the C-terminal end of the ribosomal P2beta protein of Trypanosoma cruzi associate with a specific p...

    ID: 1374411

    Description: epitope description:DDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus Swiss

    Publication: 16178868;

  68. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374414

    Description: epitope description:LNFKGRWLRDRL antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptid...

    Publication: 11179365;

  69. The beta1 adrenergic effects of antibodies against the C-terminal end of the ribosomal P2beta protein of Trypanosoma cruzi associate with a specific p...

    ID: 1374418

    Description: epitope description:EFPAAPAKAEAKEESEESDEDMGFGLFD antigen name:60S acidic ribosomal protein P0 host organism:Mus musculus

    Publication: 16178868;

  70. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374424

    Description: epitope description:LNFKGRWLRDRL antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptid...

    Publication: 11179365;

  71. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374437

    Description: epitope description:RYETSNDNSLI antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptide...

    Publication: 11179365;

  72. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374439

    Description: epitope description:RYETSNDNSLI antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptide...

    Publication: 11179365;

  73. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374441

    Description: epitope description:RYETSNDNSLI antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptide...

    Publication: 11179365;

  74. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374451

    Description: epitope description:YNSSRSYWT antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptide 4

    Publication: 11179365;

  75. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374457

    Description: epitope description:GQVSIGDENSA antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptide...

    Publication: 11179365;

  76. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374458

    Description: epitope description:GQVSIGDENSA antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptide...

    Publication: 11179365;

  77. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374460

    Description: epitope description:GQVSIGDENSA antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptide...

    Publication: 11179365;

  78. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374474

    Description: epitope description:ANDQGNRTTPSYVAFTDSERL antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  79. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374477

    Description: epitope description:TDSERLIGDAAKNQV antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  80. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374480

    Description: epitope description:IGDAAKNQVAMNPRN antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  81. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374486

    Description: epitope description:RLIGRKFSDPVVQSD antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  82. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374487

    Description: epitope description:KFSDPVVQSDMKHWPF antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  83. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374492

    Description: epitope description:FRGETKTFNPEEVSS antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  84. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374495

    Description: epitope description:LGKQVKKAVVTVPAYFNDSQ antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  85. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374498

    Description: epitope description:YFNDSQRQATKDAGT antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  86. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374512

    Description: epitope description:HLGGEDFDNRLVAHF antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  87. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374516

    Description: epitope description:RKNKGKDLSTNLRAL antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  88. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374518

    Description: epitope description:LRRLRTACERAKRTL antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  89. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374521

    Description: epitope description:FEELCGELFRGTLQPV antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  90. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374523

    Description: epitope description:VERVLQDAKMDKRAV antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  91. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374527

    Description: epitope description:IPKVMQLVSDFFRGKELKKS antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  92. Mapping of antigenic determinants of the T. cruzi hsp70 in chagasic and healthy individuals.

    ID: 1374547

    Description: epitope description:KRNQIVLTNDKGRLS antigen name:Glucose-regulated protein 78, putative (UniProt:K4DS68) host organism:Homo sapiens

    Publication: 8366861;

  93. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374615

    Description: epitope description:NPIDATARS host organism:Mus musculus BALB/c antibody name:anti-peptide 1445 (B23)

    Publication: 11179365;

  94. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374622

    Description: epitope description:NPIDATARS host organism:Mus musculus BALB/c antibody name:anti-peptide 1445 (B23)

    Publication: 11179365;

  95. Inhibition of equine herpesvirus type 1 subtype 1-induced ribonucleotide reductase by the nonapeptide YAGAVVNDL.

    ID: 1374624

    Description: epitope description:MASRPAASSPVE antigen name:Ribonucleoside-diphosphate reductase large subunit host organism:Oryctolagus cuniculus

    Publication: 2161904;

  96. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374628

    Description: epitope description:YSVDDGETW antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus BALB/c antibody name:anti-peptide 143...

    Publication: 11179365;

  97. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374632

    Description: epitope description:YSVDDGETW antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus BALB/c antibody name:anti-peptide 143...

    Publication: 11179365;

  98. Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

    ID: 1374633

    Description: epitope description:YSVDDGETW antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus BALB/c antibody name:anti-peptide 143...

    Publication: 11179365;

  99. Identification of major antigenic domains of duck hepatitis B virus pre-S protein by peptide scanning.

    ID: 1355085

    Description: epitope description:EEDQKARE antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 7510440;

  100. Identification of major antigenic domains of duck hepatitis B virus pre-S protein by peptide scanning.

    ID: 1355087

    Description: epitope description:DQKAREAF antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 7510440;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston