Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. A monoclonal anti-IgE antibody against an epitope (amino acids 367-376) in the CH3 domain inhibits IgE binding to the low affinity IgE receptor (CD23)...

    ID: 1594401

    Description: epitope description:KGTVNLTWSR antigen name:Immunoglobulin host organism:Mus musculus BALB/c antibody name:mAb 27

    Publication: 2459242;

  2. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594582

    Description: epitope description:NIIRTKKQ host organism:Mus musculus BALB/c

    Publication: 7494275;

  3. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594584

    Description: epitope description:QFFRRMDY host organism:Mus musculus BALB/c

    Publication: 7494275;

  4. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594590

    Description: epitope description:IAAQKPKV host organism:Mus musculus BALB/c

    Publication: 7494275;

  5. A mimotope from a solid-phase peptide library induces a measles virus-neutralizing and protective antibody response.

    ID: 1594602

    Description: epitope description:IAAQKPKV host organism:Mus musculus BALB/c

    Publication: 7494275;

  6. Fine specificity of the genetically controlled immune response to native and recombinant gp15/400 (polyprotein allergen) of Brugia malayi.

    ID: 1594611

    Description: epitope description:IVGDEKMAELKQMKESGLGQEELRAKVDEMLEHVTDEAKKQKIH antigen name:BMA-NPA-1, isoform a host organism:Mus musculus

    Publication: 7622210;

  7. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594651

    Description: epitope description:DAPKTFSMGAKPTGSAAANYTTAVDRPNPA antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

    Publication: 8757875;

  8. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594667

    Description: epitope description:TDSFSDFM antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

    Publication: 8757875;

  9. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594670

    Description: epitope description:TTDSFSDF antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

    Publication: 8757875;

  10. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594672

    Description: epitope description:STTDSFSD antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  11. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594677

    Description: epitope description:ALSTTDSF antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  12. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594681

    Description: epitope description:TALSTTDS antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  13. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594682

    Description: epitope description:TALSTTDS antigen name:Major outer membrane porin host organism:Mus musculus C57BL/6

    Publication: 8757875;

  14. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594686

    Description: epitope description:NATALSTT antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  15. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594689

    Description: epitope description:GNATALST antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  16. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594690

    Description: epitope description:GNATALST antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  17. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594693

    Description: epitope description:LGNATALS antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  18. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594704

    Description: epitope description:NPSLLGNA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  19. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594705

    Description: epitope description:NPSLLGNA antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  20. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594713

    Description: epitope description:TAWNPSLL antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  21. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594714

    Description: epitope description:TAWNPSLL antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  22. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594716

    Description: epitope description:LTAWNPSL antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  23. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594720

    Description: epitope description:NLTAWNPS antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  24. Characterization of the murine antibody response to peptides representing the variable domains of the major outer membrane protein of Chlamydia pneumo...

    ID: 1594723

    Description: epitope description:LNLTAWNP antigen name:Major outer membrane porin host organism:Mus musculus BALB/c

    Publication: 8757875;

  25. Major antigenic determinants of F and ColB2 pili.

    ID: 1584506

    Description: epitope description:AQGQDL antigen name:Plasmid ColB2 protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2409073;

  26. Isolation of antigenically reactive peptide fragments and localization of antigenic regions of alpha-bungarotoxin.

    ID: 1584524

    Description: epitope description:RKM antigen name:Alpha-bungarotoxin isoform A31 host organism:Oryctolagus cuniculus

    Publication: 2458724;

  27. Isolation of antigenically reactive peptide fragments and localization of antigenic regions of alpha-bungarotoxin.

    ID: 1584529

    Description: epitope description:TTATSPISA antigen name:Alpha-bungarotoxin isoform A31 host organism:Oryctolagus cuniculus

    Publication: 2458724;

  28. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584633

    Description: epitope description:LNGKIRAVNLPKVTKEKPTP antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  29. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584637

    Description: epitope description:APNYEKEPTPPTRTPDQAEP antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  30. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584638

    Description: epitope description:PTRTPDQAEPKKPTPPTYET antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  31. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584642

    Description: epitope description:PTPTPDQPEPNKPVEPTYEV antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  32. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584645

    Description: epitope description:QDLPTPPSIPTVHFHYFKLA antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  33. Effect of route of immunisation and adjuvant on T and B cell epitope recognition within a streptococcal antigen.

    ID: 1584647

    Description: epitope description:VQPQVNKEIRNNNDVNIDRT antigen name:UniProt:I6TX52 host organism:Mus musculus SJL

    Publication: 9607027;

  34. A monoclonal antibody that recognizes the predicted tick-borne encephalitis virus E protein fusion sequence blocks fusion.

    ID: 1583852

    Description: epitope description:DRGWGNHCGLFGKGSI antigen name:Genome polyprotein host organism:Mus musculus antibody name:14D2

    Publication: 10416385;

  35. Protective immunogenicity and T lymphocyte specificity of a trivalent hybrid peptide containing NH2-terminal sequences of types 5, 6, and 24 M protein...

    ID: 1583878

    Description: epitope description:RVFPRGTVENP antigen name:UniProt:A2RGM0 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2442284;

  36. Protective immunogenicity and T lymphocyte specificity of a trivalent hybrid peptide containing NH2-terminal sequences of types 5, 6, and 24 M protein...

    ID: 1583888

    Description: epitope description:TVTRGTISDPRVFPRGTVENPVATRSQTDTSEKDC host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2442284;

  37. Identification of hepatitis G virus particles in human serum by E2-specific monoclonal antibodies generated by DNA immunization.

    ID: 1583951

    Description: epitope description:LTGGFYEPL antigen name:Pegivirus C protein host organism:Mus musculus BALB/c antibody name:Mc6

    Publication: 9557757;

  38. Epitope mapping of the outer membrane protein P5-homologous fimbrin adhesin of nontypeable Haemophilus influenzae.

    ID: 1584084

    Description: epitope description:SFHDGINNNGAIKKGLSSSNYGYRRNTF antigen name:Outer membrane protein A (3aII*Gd) host organism:Chinchilla lanigera antibody name:Chinc...

    Publication: 10722609;

  39. The major outer membrane protein of Chlamydia trachomatis: critical binding site and conformation determine the specificity of antibody binding to via...

    ID: 1584090

    Description: epitope description:IFDT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus antibody name:6Ciii

    Publication: 2473372;

  40. Antigenic structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus.

    ID: 1584091

    Description: epitope description:IVQQNQSRGKGPGKKNKKKNPEK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:SDOW17

    Publication: 9801333;

  41. Epitopes associated with a synthetic hepatitis B surface antigen peptide.

    ID: 1584092

    Description: epitope description:RTCMTTAQGTSMYPSC antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:Y-2, Y-3

    Publication: 6187828;

  42. Epitope mapping of the outer membrane protein P5-homologous fimbrin adhesin of nontypeable Haemophilus influenzae.

    ID: 1584099

    Description: epitope description:GRAKLREAGKPKAKHTNHG antigen name:Outer membrane protein A (3aII*Gd) host organism:Chinchilla lanigera antibody name:Chinchilla ser...

    Publication: 10722609;

  43. Antigenic structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus.

    ID: 1584114

    Description: epitope description:IVQQNQSRGKGPGKKNKKKNPEK antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:SDOW17

    Publication: 9801333;

  44. Antigenic structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus.

    ID: 1584115

    Description: epitope description:KPHFLLATEDDVRHHFTP antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:EP147, MR40, JP25, 1D2, 2G7, 7C10

    Publication: 9801333;

  45. Synthesis of fusion proteins with multiple copies of an antigenic determinant of foot-and-mouth disease virus.

    ID: 1584117

    Description: epitope description:VPNLRGDLQVLAQKVARTLP antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2436976;

  46. Synthesis of fusion proteins with multiple copies of an antigenic determinant of foot-and-mouth disease virus.

    ID: 1584121

    Description: epitope description:NRNAVPNLRGDLQVLAQKVARTLPTS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 2436976;

  47. Synthetic vaccines against Friend murine leukaemia virus-induced erythroleukaemia: in vivo and in vitro studies with synthetic oligopeptides and seque...

    ID: 1584142

    Description: epitope description:SPHQVYN antigen name:Envelope glycoprotein host organism:Mus musculus STU

    Publication: 3469323;

  48. Synthetic vaccines against Friend murine leukaemia virus-induced erythroleukaemia: in vivo and in vitro studies with synthetic oligopeptides and seque...

    ID: 1584143

    Description: epitope description:SPHQVYN antigen name:Envelope glycoprotein host organism:Mus musculus STU

    Publication: 3469323;

  49. Synthetic vaccines against Friend murine leukaemia virus-induced erythroleukaemia: in vivo and in vitro studies with synthetic oligopeptides and seque...

    ID: 1584146

    Description: epitope description:SPHQVYN antigen name:Envelope glycoprotein host organism:Mus musculus STU

    Publication: 3469323;

  50. Synthetic vaccines against Friend murine leukaemia virus-induced erythroleukaemia: in vivo and in vitro studies with synthetic oligopeptides and seque...

    ID: 1584148

    Description: epitope description:SHRPREAK antigen name:Envelope glycoprotein host organism:Mus musculus STU

    Publication: 3469323;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston