Prophylactic vaccination with phage-displayed epitope of C. albicans elicits protective immune responses against systemic candidiasis in C57BL/6 mice.

ID: 1373014

Description: epitope description:LKVIRK antigen name:Heat shock protein 90 homolog host organism:Homo sapiens antibody name:human sera

Crossreactions and sequence homologies between recombinant polypeptides from Leishmania aethiopica and human IgG and IgM.

ID: 1373018

Description: epitope description:RVGVGRKE antigen name:Leishmania aethiopica protein host organism:Capra hircus

Crossreactions and sequence homologies between recombinant polypeptides from Leishmania aethiopica and human IgG and IgM.

ID: 1373021

Description: epitope description:GHPQQTFA antigen name:Leishmania aethiopica protein host organism:Capra hircus

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373028

Description: epitope description:FCLFFAFSVAAP antigen name:pH-regulated antigen PRA1 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit ser...

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373032

Description: epitope description:SCNATQYNQLST antigen name:pH-regulated antigen PRA1 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit ser...

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373039

Description: epitope description:RYLSQLCSGGYT antigen name:pH-regulated antigen PRA1 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit ser...

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373046

Description: epitope description:YAVRNSNSLIYY antigen name:pH-regulated antigen PRA1 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit ser...

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373049

Description: epitope description:STASSSHQHTDS antigen name:pH-regulated antigen PRA1 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit ser...

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373065

Description: epitope description:ASPTGYDWRADW antigen name:pH-regulated antigen PRA1 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit ser...

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373068

Description: epitope description:FGSKSPFFRKYF antigen name:pH-regulated antigen PRA1 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit ser...

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373080

Description: epitope description:ILFLCDDLDDKC antigen name:pH-regulated antigen PRA1 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit ser...

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373081

Description: epitope description:DDLDDKCKNDGW antigen name:pH-regulated antigen PRA1 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit ser...

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373094

Description: epitope description:TASAEVVGHFEN antigen name:pH-regulated antigen PRA1 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit ser...

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373101

Description: epitope description:ATTDANSHCHTH antigen name:pH-regulated antigen PRA1 host organism:Oryctolagus cuniculus New Zealand White antibody name:rabbit ser...

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373110

Description: epitope description:DVYA antigen name:pH-regulated antigen PRA1 host organism:Mus musculus BALB/c antibody name:mouse sera

Identification of continuous B-cell epitopes on the protein moiety of the 58-kiloDalton cell wall mannoprotein of Candida albicans belonging to a fami...

ID: 1373112

Description: epitope description:HTHADGEVHC antigen name:pH-regulated antigen PRA1 host organism:Mus musculus BALB/c antibody name:anti-C-terminal peptide (290-299...

Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

ID: 1374664

Description: epitope description:RYETSNDNSLI antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus BALB/c antibody name:anti-peptide 3

Autoimmunity in Chagas disease cardiopathy: biological relevance of a cardiac myosin-specific epitope crossreactive to an immunodominant Trypanosoma c...

ID: 1374684

Description: epitope description:NAAAAALDKKQRNFD antigen name:Myosin-7 host organism:Homo sapiens

Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

ID: 1374697

Description: epitope description:YNSSRSYWT antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus BALB/c antibody name:anti-peptide 144...

Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

ID: 1374699

Description: epitope description:YSVDDGETW antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus BALB/c antibody name:anti-peptide 144...

Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

ID: 1374707

Description: epitope description:RYETSNDNSLI antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptide...

Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

ID: 1374710

Description: epitope description:GQVSIGDENSA antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus BALB/c antibody name:anti-peptide 1...

Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

ID: 1374711

Description: epitope description:GQVSIGDENSA antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptide...

Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

ID: 1374712

Description: epitope description:YSVDDGETW antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus BALB/c antibody name:anti-peptide 144...

Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

ID: 1374713

Description: epitope description:YSVDDGETW antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-peptide 2...

Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

ID: 1374714

Description: epitope description:TPADPAASSSERG antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus BALB/c antibody name:anti-peptide...

Epitope mapping of trans-sialidase from Trypanosoma cruzi reveals the presence of several cross-reactive determinants.

ID: 1374723

Description: epitope description:TPADPAASSSERG antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus antibody name:anti-pepti...

Immunization with recombinant Trypanosoma cruzi ribosomal P2beta protein induces changes in the electrocardiogram of immunized mice.

ID: 1374757

Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus BALB/c

Immunization with recombinant Trypanosoma cruzi ribosomal P2beta protein induces changes in the electrocardiogram of immunized mice.

ID: 1374768

Description: epitope description:MGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Mus musculus BALB/c

Immunization with recombinant Trypanosoma cruzi ribosomal P2beta protein induces changes in the electrocardiogram of immunized mice.

ID: 1374770

Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Mus musculus BALB/c

Immunization with recombinant Trypanosoma cruzi ribosomal P2beta protein induces changes in the electrocardiogram of immunized mice.

ID: 1374776

Description: epitope description:MGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

Immunization with recombinant Trypanosoma cruzi ribosomal P2beta protein induces changes in the electrocardiogram of immunized mice.

ID: 1374778

Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

Characterization of the cell adhesion site of Trypanosoma cruzi metacyclic stage surface glycoprotein gp82.

ID: 1374780

Description: epitope description:RANDKGSVISLARLTEELKT antigen name:Trans-sialidase, putative (UniProt:K4DRA4) host organism:Mus musculus BALB/c antibody name:3F6

Characterization of an antibody to the cross-reacting determinant of the glycosyl-phosphatidylinositol anchor of human membrane dipeptidase.

ID: 1374812

Description: epitope description:6-(alpha-D-glucosaminyl)-1D-myo-inositol 1,2-cyclic phosphate host organism:Oryctolagus cuniculus New Zealand White

Equine herpesvirus 1 glycoprotein D: mapping of the transcript and a neutralization epitope.

ID: 1375295

Description: epitope description:CEKAKRAVRGRQDRPKEFP antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

Equine herpesvirus 1 glycoprotein D: mapping of the transcript and a neutralization epitope.

ID: 1375297

Description: epitope description:EITQNKTDPKPGQADPKPN antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus New Zealand White

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375309

Description: epitope description:EDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens antibody name:Human sera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375312

Description: epitope description:EDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens antibody name:Human sera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375313

Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens antibody name:Human sera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375317

Description: epitope description:SDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens antibody name:Human sera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375318

Description: epitope description:SDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens antibody name:Human sera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375320

Description: epitope description:SDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens antibody name:Human sera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375322

Description: epitope description:DDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens antibody name:Human sera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375325

Description: epitope description:MGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens antibody name:Human sera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375326

Description: epitope description:MGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens antibody name:Human sera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375330

Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens antibody name:Human sera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375341

Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375360

Description: epitope description:AEIVERALVSAVILAKMSVR antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375368

Description: epitope description:IMNVRRSWEELERKCLARIQ antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375379

Description: epitope description:SWIASPWKGHKPFRFEAHGS antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375382

Description: epitope description:PAAEAHAARSAAVGYYDEEE antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375386

Description: epitope description:EERQQNLQQRQQQPPPPARK antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375395

Description: epitope description:VSPQVTKASPGRVRRDSAWD antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375408

Description: epitope description:ANWPRERAWALKNPHLAYNP antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375409

Description: epitope description:KNPHLAYNPFRMPTTSTASQ antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375412

Description: epitope description:RAAVTQTASRDAADEVWALR antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375421

Description: epitope description:VATPHASARAQTVTSTPVQG antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375423

Description: epitope description:EKQVSGTPSTVPATLLQPQP antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375424

Description: epitope description:PATLLQPQPASSKTTSSRNV antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375426

Description: epitope description:GAGTSSASSARQPSASASVL antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375440

Description: epitope description:SPVKSTTGMKTVAFDLSSPQ antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Mapping of serologically relevant regions of human cytomegalovirus phosphoprotein pp150 using synthetic peptides.

ID: 1375442

Description: epitope description:GTGPQPGSAGMGGAKTPSDA antigen name:Tegument protein pp150 host organism:Homo sapiens antibody name:human sera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375448

Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375458

Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375459

Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

Human sera from varicella-zoster virus (VZV) infections cross-react with human T cell leukaemia virus type 1 (HTLV-1): common epitopes in VZV gene 22 ...

ID: 1375465

Description: epitope description:SSPTHDPPDS antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens antibody name:HTLV-1 antisera

Human sera from varicella-zoster virus (VZV) infections cross-react with human T cell leukaemia virus type 1 (HTLV-1): common epitopes in VZV gene 22 ...

ID: 1375469

Description: epitope description:TNIPPPLALLR antigen name:Large tegument protein deneddylase host organism:Homo sapiens antibody name:HTLV-1 antisera

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375483

Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

ID: 1375484

Description: epitope description:EEEDDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

The dominant linear neutralizing antibody-binding site of glycoprotein gp86 of human cytomegalovirus is strain specific.

ID: 1375487

Description: epitope description:LDPHAFHLLL antigen name:Envelope glycoprotein H host organism:Mus musculus BALB/c antibody name:AP86-SA4

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370828

Description: epitope description:RLNNSKIYINGRLIDQKPI antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370830

Description: epitope description:LNEKEIKDLYDNQSNSGIL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370836

Description: epitope description:KKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:poly...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370839

Description: epitope description:YRLATNASQAGVEKILSAL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL antibody name:polyclo...

Immune recognition of botulinum neurotoxin type A: regions recognized by T cells and antibodies against the protective H(C) fragment (residues 855-129...

ID: 1370846

Description: epitope description:SRTLGCSWEFIPVDDGWGERPL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c antibody name:p...

Immunogenicity and protective effect against oral colonization by Streptococcus mutans of synthetic peptides of a streptococcal surface protein antige...

ID: 1370848

Description: epitope description:LERQMVHTIEVPKTDLDQA antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

Immunogenicity and protective effect against oral colonization by Streptococcus mutans of synthetic peptides of a streptococcal surface protein antige...

ID: 1370851

Description: epitope description:EPTPPTRTPDQAEPNKPTP antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

Human pregnancy-associated malaria-specific B cells target polymorphic, conformational epitopes in VAR2CSA.

ID: 1370857

Description: epitope description:KNEKKCINSKSGQGDKIQGACKRKCEK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens antibo...

Immunogenicity and protective effect against oral colonization by Streptococcus mutans of synthetic peptides of a streptococcal surface protein antige...

ID: 1370866

Description: epitope description:RGQSATATYTNLQNSYYNG antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

Immunogenicity and protective effect against oral colonization by Streptococcus mutans of synthetic peptides of a streptococcal surface protein antige...

ID: 1370876

Description: epitope description:EPTPPTRTPDQAEPNKPTP antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

Mapping the intersubunit region of influenza virus hemagglutinin: comparative CD and FTIR spectroscopic studies on multiple antigenic peptides.

ID: 1370986

Description: epitope description:ATGLRNVPQIESRGLFGAIAGFIEG antigen name:Hemagglutinin host organism:Mus musculus BALB/c

Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

ID: 1371009

Description: epitope description:DNIGNANIGFGN antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

ID: 1371011

Description: epitope description:NIGFGNRGDANI antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

ID: 1371020

Description: epitope description:RGDANIGIGNIG antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

ID: 1371027

Description: epitope description:GIGNIGDRNLGI antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

ID: 1371050

Description: epitope description:LSFTLTGNPNRP antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

Regions of high antigenicity within the hypothetical PPE major polymorphic tandem repeat open-reading frame, Rv2608, show a differential humoral respo...

ID: 1371052

Description: epitope description:LSFTLTGNPNRP antigen name:Uncharacterized PPE family protein PPE42 host organism:Homo sapiens

Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

ID: 1371076

Description: epitope description:NSNNKEYT antigen name:Genome polyprotein host organism:Cavia porcellus

Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

ID: 1371081

Description: epitope description:ASDSVGQQIKVI antigen name:Genome polyprotein host organism:Cavia porcellus

Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

ID: 1371082

Description: epitope description:CTGKFKIVKEIAETQHGTIVIRVQYEGDGSPC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

ID: 1371084

Description: epitope description:GLFGKGGIVTCAMFTC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

ID: 1371086

Description: epitope description:EPSLNEEQDKRFLCKHSMVDR antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

ID: 1371090

Description: epitope description:TPHSGEEHAVGNDTGKHGKEIKITPQSSITE antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

ID: 1371095

Description: epitope description:HQVFGAIYGAAFSGVS antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

ID: 1371096

Description: epitope description:STEQNVPDPQVG antigen name:Genome polyprotein host organism:Mus musculus

Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

ID: 1371104

Description: epitope description:VDTPWVEKESALS antigen name:Genome polyprotein host organism:Mus musculus

Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

ID: 1371107

Description: epitope description:QFPFNASDSVGQ antigen name:Genome polyprotein host organism:Mus musculus

Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

ID: 1371108

Description: epitope description:ASDSVGQQIKVI antigen name:Genome polyprotein host organism:Mus musculus

Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

ID: 1371123

Description: epitope description:CTGKFKIVKEIAETQHGTIVIRVQYEGDGSPC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

ID: 1371160

Description: epitope description:GLFGKGGIVTCAMFTC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss