Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371162

    Description: epitope description:KHSMVDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  2. Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

    ID: 1371171

    Description: epitope description:STEQNVPDPQVG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1314456;

  3. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371175

    Description: epitope description:TPHSGEEHAVGNDTGKHGKEIKITPQSSITE antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  4. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371176

    Description: epitope description:SQEGAMHTALTGATEIQMSS antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  5. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371208

    Description: epitope description:GLFGKGGIVTCAMFT antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  6. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371215

    Description: epitope description:CKIPFEIMDLEKRHVLGRL antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  7. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371216

    Description: epitope description:CKKNMEGKVVLPENLEYTIV antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  8. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371217

    Description: epitope description:VHRQWFLDLPLP antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  9. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371218

    Description: epitope description:CKIPFEIMDLEKRHVLGRL antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  10. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371221

    Description: epitope description:TPHSGEEHAVGNDTGKHGKEIKITPQSSITE antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  11. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371223

    Description: epitope description:ITVNPIVTEKDSPVNIE antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  12. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371227

    Description: epitope description:CTGKFKIVKEIAETQHGTIVIRVQYEGDGSPC antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  13. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371238

    Description: epitope description:HQVFGAIYGAAFSGVS antigen name:Genome polyprotein host organism:Mus musculus NHI Swiss

    Publication: 2371772;

  14. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371263

    Description: epitope description:CKIPFEIMDLEKRHVLGRL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2371772;

  15. Antibodies to dengue 2 virus E-glycoprotein synthetic peptides identify antigenic conformation.

    ID: 1371270

    Description: epitope description:ITVNPIVTEKDSPVNIE antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 2371772;

  16. Immunogenicity and antigenicity of chimeric picornaviruses which express hepatitis A virus (HAV) peptide sequences: evidence for a neutralization doma...

    ID: 1371291

    Description: epitope description:TFNSNNKEY antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 1314456;

  17. Characterization and mapping of a B-cell immunogenic domain in hepatitis C virus E2 glycoprotein using a yeast peptide library.

    ID: 1371354

    Description: epitope description:GIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGAND antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7510436;

  18. T cell lines specific for an immunodominant epitope of human basic protein define an encephalitogenic determinant for experimental autoimmune encephal...

    ID: 1665153

    Description: epitope description:VHFFKNIVTPRTP antigen name:Myelin basic protein host organism:Rattus norvegicus LOU/M

    Publication: 1702803;

  19. T cell lines specific for an immunodominant epitope of human basic protein define an encephalitogenic determinant for experimental autoimmune encephal...

    ID: 1665154

    Description: epitope description:VHFFKNIVTPRTP antigen name:Myelin basic protein host organism:Rattus norvegicus LOU/M

    Publication: 1702803;

  20. T cell lines specific for an immunodominant epitope of human basic protein define an encephalitogenic determinant for experimental autoimmune encephal...

    ID: 1665155

    Description: epitope description:LSLSRFSWGAEGQR antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus norvegicus LOU/M

    Publication: 1702803;

  21. The use of hapten-polysaccharide conjugates for the induction of B-cell tolerance involving IgE responses. III. Specific tolerance induced by sulphona...

    ID: 1665163

    Description: epitope description:4-sulfanilamidobenzoic acid host organism:Cavia porcellus Strain (2 X 13)

    Publication: 91585;

  22. The use of hapten-polysaccharide conjugates for the induction of B-cell tolerance involving IgE responses. II. Specific tolerance induced by sulphonam...

    ID: 1665167

    Description: epitope description:4-sulfanilamidobenzoic acid host organism:Mus musculus CBA

    Publication: 313909;

  23. The use of hapten-polysaccharide conjugates for the induction of B-cell tolerance involving IgE responses. II. Specific tolerance induced by sulphonam...

    ID: 1665175

    Description: epitope description:4-sulfanilamidobenzoic acid host organism:Mus musculus CBA

    Publication: 313909;

  24. Immunochemical specificity of antisera raised against the synthetic encephalitogenic peptide SH624, residues 59-74 of the myelin basic protein.

    ID: 1665204

    Description: epitope description:TTHYGSLPQK antigen name:Myelin basic protein host organism:Gallus gallus

    Publication: 2437472;

  25. Immunochemical specificity of antisera raised against the synthetic encephalitogenic peptide SH624, residues 59-74 of the myelin basic protein.

    ID: 1665206

    Description: epitope description:TTHYGSLPQK antigen name:Myelin basic protein host organism:Gallus gallus

    Publication: 2437472;

  26. Immunochemical specificity of antisera raised against the synthetic encephalitogenic peptide SH624, residues 59-74 of the myelin basic protein.

    ID: 1665208

    Description: epitope description:TTHYGSLPQK antigen name:Myelin basic protein host organism:Gallus gallus

    Publication: 2437472;

  27. Immunochemical specificity of antisera raised against the synthetic encephalitogenic peptide SH624, residues 59-74 of the myelin basic protein.

    ID: 1665215

    Description: epitope description:HYGSLPQK antigen name:Myelin basic protein (UniProt:P02686) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2437472;

  28. Immunochemical specificity of antisera raised against the synthetic encephalitogenic peptide SH624, residues 59-74 of the myelin basic protein.

    ID: 1665231

    Description: epitope description:TTHYGSLPQK antigen name:Myelin basic protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2437472;

  29. Reductively aminated D-xylose-albumin conjugate as the immunogen for generation of IgG and IgE antibodies specific to D-xylitol, a haptenic allergen.

    ID: 1665272

    Description: epitope description:D-xylopyranose host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17979222;

  30. Chimeric papillomavirus-like particles.

    ID: 1665298

    Description: epitope description:DTPTLH antigen name:Protein E7 host organism:Mus musculus antibody name:anti-HPV16 E7 antibody (Triton)

    Publication: 9234950;

  31. Epitopes of peptide 43-88 of guinea pig myelin basic protein: localization with monoclonal antibodies.

    ID: 1665328

    Description: epitope description:SQDENPVVHF antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis antibody name:22.17

    Publication: 6187841;

  32. Fusion loop peptide of the West Nile virus envelope protein is essential for pathogenesis and is recognized by a therapeutic cross-reactive human mono...

    ID: 1665347

    Description: epitope description:W101, G104, G106, T484 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb11

    Publication: 19535627;

  33. Fusion loop peptide of the West Nile virus envelope protein is essential for pathogenesis and is recognized by a therapeutic cross-reactive human mono...

    ID: 1665354

    Description: epitope description:W101, G104, G106, T484 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb11

    Publication: 19535627;

  34. Myelin degeneration in multiple system atrophy detected by unique antibodies.

    ID: 1665408

    Description: epitope description:QDENPVV antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:QD-9

    Publication: 9736024;

  35. High-resolution autoreactive epitope mapping and structural modeling of the 65 kDa form of human glutamic acid decarboxylase.

    ID: 1665412

    Description: epitope description:E264 antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens antibody name:M10 (MICA-10)

    Publication: 10222205;

  36. High-resolution autoreactive epitope mapping and structural modeling of the 65 kDa form of human glutamic acid decarboxylase.

    ID: 1665691

    Description: epitope description:R536, Y540 antigen name:Glutamate decarboxylase 2 host organism:Homo sapiens antibody name:M8 (MICA-8), M9 (MICA-9)

    Publication: 10222205;

  37. T cell lines specific for an immunodominant epitope of human basic protein define an encephalitogenic determinant for experimental autoimmune encephal...

    ID: 1665746

    Description: epitope description:VHFFKNIVTPRTP antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus norvegicus LOU/M

    Publication: 1702803;

  38. Hapten-specific respiratory hypersensitivity in guinea pigs.

    ID: 1665862

    Description: epitope description:4-tolyl isocyanate host organism:Cavia porcellus

    Publication: 211841;

  39. Immunological cross-reactivity to laboratory-produced HPV-11 virions of polysera raised against bacterially derived fusion proteins and synthetic pept...

    ID: 1665880

    Description: epitope description:DGDMVDTGFGAMNFADLQTNKSDVPIDI antigen name:Major capsid protein L1 (UniProt:P04012) host organism:Oryctolagus cuniculus antibody na...

    Publication: 2155503;

  40. Analysis of HPV-1 E4 gene expression using epitope-defined antibodies.

    ID: 1665955

    Description: epitope description:HLYADGLTD antigen name:Probable protein E4 host organism:Mus musculus BALB/c antibody name:mAb 4.37

    Publication: 2456213;

  41. Immunolocalization of proteolipid protein peptide 103-116 in myelin.

    ID: 1666399

    Description: epitope description:YKTTICGKGLSATV antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus

    Publication: 7511704;

  42. Vaccination with DNA encoding an immunodominant myelin basic protein peptide targeted to Fc of immunoglobulin G suppresses experimental autoimmune enc...

    ID: 1666453

    Description: epitope description:HYGSLPQKSQRSQDENPV antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis

    Publication: 9565646;

  43. Detection of cell-drug (hapten)-antibody complexes by the gel test.

    ID: 1666473

    Description: epitope description:(+)-catechin host organism:Homo sapiens

    Publication: 1502708;

  44. Identification of an encephalitogenic determinant of myelin proteolipid protein for the rabbit.

    ID: 1666554

    Description: epitope description:TGGQKGRGSRGQHQAHSLER antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1699974;

  45. Identification of an encephalitogenic determinant of myelin proteolipid protein for the rabbit.

    ID: 1666562

    Description: epitope description:MIAATYNFAVLKLMGRGTKF antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1699974;

  46. Identification of an encephalitogenic determinant of myelin proteolipid protein for the rabbit.

    ID: 1666569

    Description: epitope description:EALTGTEKLIETYFSKNYQDYE antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1699974;

  47. Identification of an encephalitogenic determinant of myelin proteolipid protein for the rabbit.

    ID: 1666576

    Description: epitope description:TGGQKGRGSRGQHQAHSLER antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1699974;

  48. Identification of an encephalitogenic determinant of myelin proteolipid protein for the rabbit.

    ID: 1666583

    Description: epitope description:MIAATYNFAVLKLMGRGTKF antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1699974;

  49. Penicillamine and penicillin can generate antigenic determinants on rat peritoneal cells in vitro.

    ID: 1666597

    Description: epitope description:D-penicillamine host organism:Oryctolagus cuniculus

    Publication: 1709917;

  50. Penicillamine and penicillin can generate antigenic determinants on rat peritoneal cells in vitro.

    ID: 1666602

    Description: epitope description:benzylpenicilloyl group host organism:Oryctolagus cuniculus

    Publication: 1709917;

  51. Activation and hapten inhibition of mast cells sensitized with monoclonal IgE anti-penicillin antibodies: evidence for two-site recognition of the pen...

    ID: 1666606

    Description: epitope description:benzylpenicilloyl group host organism:Mus musculus C57BL/6 antibody name:BIE-13CE

    Publication: 7589115;

  52. Immunochemical analysis of sulfonamide drug allergy: identification of sulfamethoxazole-substituted human serum proteins.

    ID: 1666613

    Description: epitope description:penicillin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7798534;

  53. Immunological analysis of the amino terminal and the C8 isomer of human myelin basic protein.

    ID: 1666697

    Description: epitope description:ASQKRPSQR + ACET(1A) antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL antibody name:F23C6, F28C4 a...

    Publication: 7689598;

  54. Defective T helper cell epitope responsible for the failure of region 69-84 of the human myelin basic protein to induce experimental allergic encephal...

    ID: 1666704

    Description: epitope description:GSLPQKSQRSQDEN antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis

    Publication: 2479765;

  55. Comparison of the antibody response to bee venom phospholipase A2 induced by natural exposure in humans or by immunization in mice.

    ID: 1666719

    Description: epitope description:EHPVTGCGERTEGRCLHYTV antigen name:Api m 1 host organism:Mus musculus BALB/c antibody name:3F3, 1D12, 3H8, 1C11, 2B6, 2F5

    Publication: 9376132;

  56. Fusion loop peptide of the West Nile virus envelope protein is essential for pathogenesis and is recognized by a therapeutic cross-reactive human mono...

    ID: 1666731

    Description: epitope description:W101, G104, G106, T484 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb11

    Publication: 19535627;

  57. Fusion loop peptide of the West Nile virus envelope protein is essential for pathogenesis and is recognized by a therapeutic cross-reactive human mono...

    ID: 1666744

    Description: epitope description:W101, G104, G106, T484 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb11

    Publication: 19535627;

  58. Monoclonal and polyclonal antibody responses to the myelin basic protein epitope present in human urine.

    ID: 1666763

    Description: epitope description:TQDENP antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:F41B5 (7CB5)

    Publication: 7515900;

  59. Monoclonal and polyclonal antibody responses to the myelin basic protein epitope present in human urine.

    ID: 1666764

    Description: epitope description:PQDENPVVHF antigen name:Myelin basic protein host organism:Mus musculus BALB/c antibody name:F41B5 (7CB5), F41C11 (7CC11)

    Publication: 7515900;

  60. Monoclonal and polyclonal antibody responses to the myelin basic protein epitope present in human urine.

    ID: 1666835

    Description: epitope description:QKSHGRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:F41B5 (7CB5)

    Publication: 7515900;

  61. Monoclonal and polyclonal antibody responses to the myelin basic protein epitope present in human urine.

    ID: 1666839

    Description: epitope description:QKSHGRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:F41B5 (7CB5)

    Publication: 7515900;

  62. Phthalic anhydride allergy: development and characterization of optimized hapten-carrier conjugates for improved diagnosis.

    ID: 1666886

    Description: epitope description:phthalic anhydride host organism:Homo sapiens

    Publication: 12269934;

  63. Detection of human IgE to sulfamethoxazole by skin testing with sulfamethoxazoyl-poly-L-tyrosine.

    ID: 1666897

    Description: epitope description:sulfamethoxazole host organism:Homo sapiens

    Publication: 1955637;

  64. Detection of human IgE to sulfamethoxazole by skin testing with sulfamethoxazoyl-poly-L-tyrosine.

    ID: 1666906

    Description: epitope description:penicillin host organism:Homo sapiens

    Publication: 1955637;

  65. Detection of human IgE to sulfamethoxazole by skin testing with sulfamethoxazoyl-poly-L-tyrosine.

    ID: 1666909

    Description: epitope description:benzylpenicilloyl-benzylamine host organism:Homo sapiens

    Publication: 1955637;

  66. Studies on N1-DNCP-N6-lactobionoyl-1,6-hexanediamine--a distinctive monovalent anaphylactogen.

    ID: 1666951

    Description: epitope description:3,5-dinitrosalicylic acid host organism:Oryctolagus cuniculus

    Publication: 4077350;

  67. Basic aspects related to penicillin-allergy skin testing: on the variability of the hapten-paratope interaction.

    ID: 1667046

    Description: epitope description:carbenicilloyl group host organism:Cavia porcellus

    Publication: 7503403;

  68. B cells play a cooperative role via CD40L-CD40 interaction in T cell-mediated experimental autoimmune neuritis in Lewis rats.

    ID: 1667058

    Description: epitope description:SSKRGRQTPVLYAMLDH antigen name:Myelin protein P0 host organism:Rattus norvegicus Lewis

    Publication: 17188497;

  69. Allergy to penicillin unsuccessfully treated with a haptenic inhibitor (benzyl-penicilloyl-N2-formil-lysine; BPO-flys). A case report.

    ID: 1667080

    Description: epitope description:benzylpenicilloyl group host organism:Homo sapiens

    Publication: 709786;

  70. Equilibrium and nonequilibrium competitive inhibitions of antipeptide antibody binding by parent myelin basic protein and 18 related peptide sequences...

    ID: 1667216

    Description: epitope description:TTHYGSLPQKAQGHRPQDE antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis

    Publication: 6168926;

  71. Evaluation of antibody binding to diisocyanate protein conjugates in a general population.

    ID: 1667276

    Description: epitope description:hexamethylene diisocyanate host organism:Homo sapiens

    Publication: 17042142;

  72. The induction of respiratory allergy in guinea-pigs following intradermal injection of trimellitic anhydride: a comparison with the response to 2,4-di...

    ID: 1667280

    Description: epitope description:trimellitic anhydride host organism:Cavia porcellus Duncan-Hartley

    Publication: 2469142;

  73. The induction of respiratory allergy in guinea-pigs following intradermal injection of trimellitic anhydride: a comparison with the response to 2,4-di...

    ID: 1667287

    Description: epitope description:2,4-dinitrophenyl group host organism:Cavia porcellus Duncan-Hartley

    Publication: 2469142;

  74. Equilibrium and nonequilibrium competitive inhibitions of antipeptide antibody binding by parent myelin basic protein and 18 related peptide sequences...

    ID: 1667573

    Description: epitope description:TTHYGSLPQKAQGHRPQDE antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis

    Publication: 6168926;

  75. Equilibrium and nonequilibrium competitive inhibitions of antipeptide antibody binding by parent myelin basic protein and 18 related peptide sequences...

    ID: 1667574

    Description: epitope description:TTHYGSLPQKAQGHRPQDE antigen name:Myelin basic protein host organism:Oryctolagus cuniculus

    Publication: 6168926;

  76. Recognition of the immunodominant myelin basic protein peptide by autoantibodies and HLA-DR2-restricted T cell clones from multiple sclerosis patients...

    ID: 1667602

    Description: epitope description:TGGVYHFVKKHVHES antigen name:DNA polymerase catalytic subunit host organism:Homo sapiens

    Publication: 9276728;

  77. Recognition of the immunodominant myelin basic protein peptide by autoantibodies and HLA-DR2-restricted T cell clones from multiple sclerosis patients...

    ID: 1667633

    Description: epitope description:ELLHQRFFKNVESTP antigen name:AngR host organism:Homo sapiens

    Publication: 9276728;

  78. Recognition of the immunodominant myelin basic protein peptide by autoantibodies and HLA-DR2-restricted T cell clones from multiple sclerosis patients...

    ID: 1667636

    Description: epitope description:GIDFDKFFKNRIDTF antigen name:Other Staphylococcus aureus protein host organism:Homo sapiens

    Publication: 9276728;

  79. Recognition of the immunodominant myelin basic protein peptide by autoantibodies and HLA-DR2-restricted T cell clones from multiple sclerosis patients...

    ID: 1667637

    Description: epitope description:RNKIRQFFKNQDKEL antigen name:K00951 GTP pyrophosphokinase host organism:Homo sapiens

    Publication: 9276728;

  80. Gating the selectivity filter in ClC chloride channels.

    ID: 1667737

    Description: epitope description:A: K243, D246, P248, L249, N250, P380, Q381, Y382, H383; B: I231, H234, E235 antigen name:H(+)/Cl(-) exchange transporter ClcA hos...

    Publication: 12649487;

  81. Gating the selectivity filter in ClC chloride channels.

    ID: 1667738

    Description: epitope description:A: K243, D246, P248, L249, N250, P380, Q381, Y382, H383; B: I231, H234, E235 antigen name:H(+)/Cl(-) exchange transporter ClcA hos...

    Publication: 12649487;

  82. A survey of the prevalence of penicillin-specific IgG, IgM and IgE antibodies detected by ELISA and defined by hapten inhibition, in patients with sus...

    ID: 1667761

    Description: epitope description:benzylpenicilloyl group host organism:Homo sapiens

    Publication: 3358899;

  83. Induction and modification of anti-TNP reaginic and IgG antibody responses by reactive trinitrophenyl derivatives.

    ID: 1667813

    Description: epitope description:2,4,6-trinitrophenyl group host organism:Mus musculus CBA

    Publication: 361549;

  84. Immunoglobulin E antibodies to rocuronium: a new diagnostic tool.

    ID: 1668079

    Description: epitope description:vecuronium host organism:Homo sapiens

    Publication: 17667569;

  85. Monoclonal antibodies to human myelin basic protein.

    ID: 1668090

    Description: epitope description:DHARHGFLPRHRDTGIL antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL antibody name:Mab 1

    Publication: 2415682;

  86. Monoclonal antibodies to human myelin basic protein.

    ID: 1668093

    Description: epitope description:DHARHGFLPRHRDTGIL antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL antibody name:Mab 1

    Publication: 2415682;

  87. Monoclonal antibodies to human myelin basic protein.

    ID: 1668105

    Description: epitope description:GSLPQKSHGRTQDENPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL antibody name:Mab 3

    Publication: 2415682;

  88. Monoclonal antibodies to human myelin basic protein.

    ID: 1668134

    Description: epitope description:FKNIVTPRTPPPSQGKGRGLSLSRFSW antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL antibody name...

    Publication: 2415682;

  89. Monoclonal antibodies to human myelin basic protein.

    ID: 1668135

    Description: epitope description:AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL ...

    Publication: 2415682;

  90. Generation of an antibody specific to erythritol, a non-immunogenic food additive.

    ID: 1668217

    Description: epitope description:erythritol host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16901854;

  91. Generation of an antibody specific to erythritol, a non-immunogenic food additive.

    ID: 1668234

    Description: epitope description:erythritol host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16901854;

  92. Generation of an antibody specific to erythritol, a non-immunogenic food additive.

    ID: 1668235

    Description: epitope description:erythritol host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16901854;

  93. Generation of an antibody specific to erythritol, a non-immunogenic food additive.

    ID: 1668239

    Description: epitope description:erythritol host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16901854;

  94. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674222

    Description: epitope description:aztreonam host organism:Mus musculus BALB/c antibody name:Az-3

    Publication: 1384868;

  95. Antigenicity of beta-lactam antibiotic preparations: production of IgE antibodies to beta-lactam antibiotic and their cross-reaction within the antibi...

    ID: 1674251

    Description: epitope description:benzylpenicillin host organism:Mus musculus BALB/c

    Publication: 6176550;

  96. Antigenicity of beta-lactam antibiotic preparations: production of IgE antibodies to beta-lactam antibiotic and their cross-reaction within the antibi...

    ID: 1674257

    Description: epitope description:cefalotin host organism:Mus musculus BALB/c

    Publication: 6176550;

  97. Antigenicity of beta-lactam antibiotic preparations: production of IgE antibodies to beta-lactam antibiotic and their cross-reaction within the antibi...

    ID: 1674258

    Description: epitope description:cefalotin host organism:Mus musculus BALB/c

    Publication: 6176550;

  98. Antigenicity of beta-lactam antibiotic preparations: production of IgE antibodies to beta-lactam antibiotic and their cross-reaction within the antibi...

    ID: 1674271

    Description: epitope description:cefmetazole sodium host organism:Mus musculus BALB/c

    Publication: 6176550;

  99. Antigenicity of beta-lactam antibiotic preparations: production of IgE antibodies to beta-lactam antibiotic and their cross-reaction within the antibi...

    ID: 1674274

    Description: epitope description:carbenicillin host organism:Mus musculus BALB/c

    Publication: 6176550;

  100. Epitope analysis of aztreonam by antiaztreonam monoclonal antibodies and possible consequences in beta-lactams hypersensitivity.

    ID: 1674284

    Description: epitope description:aztreonam host organism:Mus musculus BALB/c antibody name:Az-3

    Publication: 1384868;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston