Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Synthetic peptides used to locate the alpha-bungarotoxin binding site and immunogenic regions on alpha subunits of the nicotinic acetylcholine recepto...

    ID: 1585025

    Description: epitope description:YCEIIVTHFPFDQQNCT antigen name:Acetylcholine receptor subunit alpha host organism:Rattus norvegicus

    Publication: 2443159;

  2. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585028

    Description: epitope description:RHKQKIVA antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  3. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585031

    Description: epitope description:QKIVAPVK antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  4. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585039

    Description: epitope description:KQTLPPSV host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  5. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585045

    Description: epitope description:SVPNLRGD host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  6. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585046

    Description: epitope description:VPNLRGDL antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  7. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585053

    Description: epitope description:DLQVLAQK antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  8. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585056

    Description: epitope description:VLAQKVAR antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  9. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585057

    Description: epitope description:LAQKVART antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  10. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585059

    Description: epitope description:QKVARTPC host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  11. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585072

    Description: epitope description:HKQKIIAP antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  12. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585077

    Description: epitope description:QKIIAPAK antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  13. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585078

    Description: epitope description:QKIIAPAK antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  14. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585086

    Description: epitope description:IAPAKQLL antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  15. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586645

    Description: epitope description:AALTAENTAIKQRNENAKA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  16. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586649

    Description: epitope description:KANADAKAAYEAAVAANNA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  17. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586651

    Description: epitope description:AANNAANAALTAENTAIKK antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  18. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586659

    Description: epitope description:AKLAQYQADLAAVQKTNAA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  19. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586665

    Description: epitope description:LKQYEADLAAVKKANAANE antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  20. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586679

    Description: epitope description:KATYEAAVAANNAKNAALT antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  21. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586680

    Description: epitope description:YQAKLTAYQTELARVQKAN antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  22. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B...

    ID: 1587098

    Description: epitope description:AGAFARAVEGAEVIEVRAIGSTSVMLNACY antigen name:Major surface protein 2 (MSP2) host organism:Bos taurus

    Publication: 15557669;

  23. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B...

    ID: 1587100

    Description: epitope description:PYACAGIGGNFVSVVDGHINPKFAYRVKAG antigen name:Major surface protein 2 (MSP2) host organism:Bos taurus

    Publication: 15557669;

  24. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B...

    ID: 1587109

    Description: epitope description:EGNKDTINLQGMANNINNLSKEDKAV antigen name:Major surface protein 2 (MSP2) host organism:Bos taurus

    Publication: 15557669;

  25. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587150

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:1C11

    Publication: 2563272;

  26. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587152

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:1C11

    Publication: 2563272;

  27. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587153

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 2563272;

  28. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1587154

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Mus musculus BALB/c antibody name:1C11

    Publication: 2563272;

  29. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587168

    Description: epitope description:EQCGRQAGGK antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  30. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587173

    Description: epitope description:RQAGGKLCPN antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  31. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587175

    Description: epitope description:AGGKLCPNNL antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  32. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587176

    Description: epitope description:GKLCPNNLCC antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  33. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587178

    Description: epitope description:LCPNNLCCSQ antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  34. Longitudinal analyses of immune responses to Plasmodium falciparum derived peptides corresponding to novel blood stage antigens in coastal Kenya.

    ID: 1587209

    Description: epitope description:QLEEKTKQYNDLQNNMKTIKEQNEHLKNKFQSMGK antigen name:Uncharacterized protein (UniProt:Q8IHV2) host organism:Homo sapiens

    Publication: 18342997;

  35. Longitudinal analyses of immune responses to Plasmodium falciparum derived peptides corresponding to novel blood stage antigens in coastal Kenya.

    ID: 1587210

    Description: epitope description:EKMNMKMEQMDMKMEKIDVNMDQMDVKMEQMDVKMEQMDVKMKRMNK antigen name:Uncharacterized protein PFB0315w host organism:Homo sapiens

    Publication: 18342997;

  36. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587250

    Description: epitope description:PDHNCQSNCK antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  37. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587298

    Description: epitope description:SASNVLATYH antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  38. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587300

    Description: epitope description:SNVLATYHLY antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  39. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587303

    Description: epitope description:VLATYHLYNS antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  40. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587309

    Description: epitope description:LYNSQDHGWD antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  41. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587331

    Description: epitope description:WDANKPYSWR antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  42. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587335

    Description: epitope description:KPYSWRSKYG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  43. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587339

    Description: epitope description:WRSKYGWTAF antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  44. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587347

    Description: epitope description:AFCGPVGAHG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  45. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587356

    Description: epitope description:HGQSSCGKCL antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  46. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587363

    Description: epitope description:CLSVTNTGTG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  47. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587367

    Description: epitope description:TNTGTGAKTT antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  48. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587372

    Description: epitope description:TGAKTTVRIV antigen name:Hev b 6 host organism:Oryctolagus cuniculus

    Publication: 9097919;

  49. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587384

    Description: epitope description:CSNGGLDLDV antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;

  50. IgE epitope analysis of the hevein preprotein; a major latex allergen.

    ID: 1587388

    Description: epitope description:GLDLDVNVFR antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9097919;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston