Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification of neutralizing epitopes on Pseudomonas aeruginosa elastase and effects of cross-reactions on other thermolysin-like proteases.

    ID: 1589467

    Description: epitope description:RYMDQPSRD antigen name:Elastase host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9009299;

  2. Identification of neutralizing epitopes on Pseudomonas aeruginosa elastase and effects of cross-reactions on other thermolysin-like proteases.

    ID: 1589478

    Description: epitope description:HGFTEQNSG antigen name:Elastase host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9009299;

  3. Epitope mapping and affinity purification of monospecific antibodies by Escherichia coli cell surface display of gene-derived random peptide libraries...

    ID: 1589496

    Description: epitope description:CRYDKNTDVNV antigen name:Genome polyprotein host organism:Mus musculus antibody name:24/16

    Publication: 11687250;

  4. Mapping of a fusion related epitope of the respiratory syncytial virus fusion protein.

    ID: 1589506

    Description: epitope description:SKVLHLEGEVNKIKS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 1711741;

  5. Mapping of a fusion related epitope of the respiratory syncytial virus fusion protein.

    ID: 1589507

    Description: epitope description:SKVLHLEGEVNKIKS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 1711741;

  6. Mapping of a fusion related epitope of the respiratory syncytial virus fusion protein.

    ID: 1589513

    Description: epitope description:INDMPITNDQKKL antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 1711741;

  7. Mapping of a fusion related epitope of the respiratory syncytial virus fusion protein.

    ID: 1589515

    Description: epitope description:PLCTTNTKEGSNICLTRTDRG antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus

    Publication: 1711741;

  8. Mapping of a fusion related epitope of the respiratory syncytial virus fusion protein.

    ID: 1589516

    Description: epitope description:QQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWK antigen name:Fusion glycoprotein F0 host organism:Mus musculus antibody name:L4

    Publication: 1711741;

  9. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590059

    Description: epitope description:QTELARVQKA antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  10. Analysis of the IgE-epitope of Der f 2, a major mite allergen, by in vitro mutagenesis.

    ID: 1590061

    Description: epitope description:IATHAKIRD antigen name:Der f 2 host organism:Homo sapiens

    Publication: 8544851;

  11. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590066

    Description: epitope description:VKPTAPTKPT antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  12. Identification of antigenic epitopes in a surface protein antigen of Streptococcus mutans in humans.

    ID: 1590072

    Description: epitope description:AANNAKNAAL antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 7520424;

  13. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585104

    Description: epitope description:LLPPSGSG host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  14. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585105

    Description: epitope description:LLPPSGSG host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  15. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585107

    Description: epitope description:LPPSGSGR host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  16. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585108

    Description: epitope description:LPPSGSGR host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  17. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585109

    Description: epitope description:LPPSGSGR host organism:Bos taurus

    Publication: 1372368;

  18. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585116

    Description: epitope description:SGSGRRGD host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  19. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585130

    Description: epitope description:SGRRGDMG antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  20. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585138

    Description: epitope description:RGDMGSLA antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 1372368;

  21. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585147

    Description: epitope description:MGSLAARV antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  22. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585150

    Description: epitope description:GSLAARVV antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  23. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585161

    Description: epitope description:AARVVKQP host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  24. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585166

    Description: epitope description:RVVKQPCG host organism:Bos taurus

    Publication: 1372368;

  25. Synthetic peptides used to locate the alpha-bungarotoxin binding site and immunogenic regions on alpha subunits of the nicotinic acetylcholine recepto...

    ID: 1585173

    Description: epitope description:SDISGKQVTGEVIFQT antigen name:Acetylcholine receptor subunit alpha host organism:Rattus norvegicus

    Publication: 2443159;

  26. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585276

    Description: epitope description:RYDSRPPEDVF antigen name:Pertussis toxin subunit 1 host organism:Mus musculus BALB/c

    Publication: 2480389;

  27. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585278

    Description: epitope description:RYDSRPPEDVF antigen name:Pertussis toxin subunit 1 host organism:Mus musculus BALB/c

    Publication: 2480389;

  28. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585279

    Description: epitope description:RYDSRPPEDVF antigen name:Pertussis toxin subunit 1 host organism:Homo sapiens

    Publication: 2480389;

  29. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585311

    Description: epitope description:DNVLDHLTGRSC antigen name:Pertussis toxin subunit 1 host organism:Homo sapiens

    Publication: 2480389;

  30. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585313

    Description: epitope description:DNVLDHLTGRSC antigen name:Pertussis toxin subunit 1 host organism:Mus musculus BALB/c

    Publication: 2480389;

  31. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585315

    Description: epitope description:DNVLDHLTGRSC antigen name:Pertussis toxin subunit 1 host organism:Mus musculus BALB/c

    Publication: 2480389;

  32. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585336

    Description: epitope description:RANPNPYTSRRSV antigen name:Pertussis toxin subunit 1 host organism:Mus musculus BALB/c

    Publication: 2480389;

  33. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585341

    Description: epitope description:GAASSYFEYVDTYG antigen name:Pertussis toxin subunit 1 host organism:Homo sapiens

    Publication: 2480389;

  34. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585342

    Description: epitope description:GAASSYFEYVDTYG antigen name:Pertussis toxin subunit 1 host organism:Mus musculus BALB/c

    Publication: 2480389;

  35. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585344

    Description: epitope description:GAASSYFEYVDTYG antigen name:Pertussis toxin subunit 1 host organism:Mus musculus C3H

    Publication: 2480389;

  36. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585345

    Description: epitope description:GAASSYFEYVDTYG antigen name:Pertussis toxin subunit 1 host organism:Mus musculus BALB.B

    Publication: 2480389;

  37. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585349

    Description: epitope description:RILAGALATYQ antigen name:Pertussis toxin subunit 1 host organism:Mus musculus BALB/c

    Publication: 2480389;

  38. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585353

    Description: epitope description:RILAGALATYQ antigen name:Pertussis toxin subunit 1 host organism:Mus musculus BALB/c

    Publication: 2480389;

  39. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585360

    Description: epitope description:RIPPENIRRVT antigen name:Pertussis toxin subunit 1 host organism:Mus musculus BALB/c

    Publication: 2480389;

  40. Multiple T and B cell epitopes in the S1 subunit (""A""-monomer) of the pertussis toxin molecule.

    ID: 1585365

    Description: epitope description:RVYHNGITGET antigen name:Pertussis toxin subunit 1 host organism:Mus musculus C57BL/6

    Publication: 2480389;

  41. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585383

    Description: epitope description:DAKDGKEIDTKHLPSTC antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  42. Epitope mapping of polyclonal and monoclonal antibodies against two alpha-bungarotoxin-binding alpha subunits from neuronal nicotinic receptors.

    ID: 1585400

    Description: epitope description:TTNIWLQMYWTDHYLQWNVSE antigen name:Neuronal acetylcholine receptor subunit alpha-7 host organism:Rattus norvegicus Lewis

    Publication: 1374423;

  43. Epitope mapping of polyclonal and monoclonal antibodies against two alpha-bungarotoxin-binding alpha subunits from neuronal nicotinic receptors.

    ID: 1585418

    Description: epitope description:FLLPADSGEKISLGITVLLSL antigen name:Neuronal acetylcholine receptor subunit alpha-7 host organism:Rattus norvegicus Lewis

    Publication: 1374423;

  44. Neutralizing monoclonal antibody specific for alpha-bungarotoxin: preparation and characterization of the antibody, and localization of antigenic regi...

    ID: 1585420

    Description: epitope description:SSRGK antigen name:Alpha-bungarotoxin isoform A31 host organism:Mus musculus BALB/c antibody name:MaB-2311

    Publication: 2476330;

  45. Epitope mapping of polyclonal and monoclonal antibodies against two alpha-bungarotoxin-binding alpha subunits from neuronal nicotinic receptors.

    ID: 1585422

    Description: epitope description:FASTMIIVGLSVVVTVIVLQ antigen name:Neuronal acetylcholine receptor subunit alpha-7 host organism:Rattus norvegicus Lewis

    Publication: 1374423;

  46. Epitope mapping of polyclonal and monoclonal antibodies against two alpha-bungarotoxin-binding alpha subunits from neuronal nicotinic receptors.

    ID: 1585425

    Description: epitope description:FLRMKRPGEDKVRPACQHKQ antigen name:Neuronal acetylcholine receptor subunit alpha-7 host organism:Rattus norvegicus Lewis

    Publication: 1374423;

  47. Epitope mapping of polyclonal and monoclonal antibodies against two alpha-bungarotoxin-binding alpha subunits from neuronal nicotinic receptors.

    ID: 1585433

    Description: epitope description:DRLCLMAFSVFTIICTIGIL antigen name:Neuronal acetylcholine receptor subunit alpha-7 host organism:Rattus norvegicus Lewis

    Publication: 1374423;

  48. Expression of measles virus nucleoprotein in Escherichia coli: use of deletion mutants to locate the antigenic sites.

    ID: 1585458

    Description: epitope description:SRASDARAAHLPTGTPLDID antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:mAb 25

    Publication: 2471789;

  49. Epitope mapping of polyclonal and monoclonal antibodies against two alpha-bungarotoxin-binding alpha subunits from neuronal nicotinic receptors.

    ID: 1585461

    Description: epitope description:LQFHHHDPQAGKMPRWVRVI antigen name:Alpha8 subunit of nicotinic acetylcholine receptor host organism:Rattus norvegicus Lewis

    Publication: 1374423;

  50. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585476

    Description: epitope description:CCRHKQKIVAPVKQTLPPSVPNLRGDLQVLAQKVARTPCG host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston