Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585486

    Description: epitope description:CCRHKQKIVAPVKQTLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  2. Cross-reactive and serotype-specific antibodies against foot-and-mouth disease virus generated by different regions of the same synthetic peptide.

    ID: 1585487

    Description: epitope description:CCRHKQKIVAPVKQTLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus Duncan-Hartley

    Publication: 1372368;

  3. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585528

    Description: epitope description:SLWARRENGSVKWFC antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  4. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585532

    Description: epitope description:SLWARRENGSVKWFC antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  5. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585540

    Description: epitope description:PPSDIKGKYVKEVEVK antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  6. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585542

    Description: epitope description:EGQKSAVTEY antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  7. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585544

    Description: epitope description:PPSDIKGKYVKEVEVK antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  8. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585546

    Description: epitope description:EGQKSAVTEY antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  9. Strain-specific and common epitopes of gonococcal pili.

    ID: 1585548

    Description: epitope description:PPSDIKGKYVKEVEVK antigen name:UniProt:D1DKT5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 6203999;

  10. Characterization of a dominant antigenic determinant of Par o I encoded by recombinant DNA.

    ID: 1585652

    Description: epitope description:GTSSCRLVP antigen name:Par j 1 host organism:Oryctolagus cuniculus antibody name:anti-6a FP

    Publication: 8835131;

  11. Microinjected antibodies against the cytoplasmic domain of vesicular stomatitis virus glycoprotein block its transport to the cell surface.

    ID: 1585732

    Description: epitope description:KRQIYTDIEMNRLGK antigen name:Indiana vesiculovirus protein host organism:Oryctolagus cuniculus

    Publication: 3013626;

  12. The idiotypic characterization of the immune response to a defined epitope of a protein antigen and the specific in vivo suppression of the immune res...

    ID: 1585738

    Description: epitope description:TTAETLDATR antigen name:Capsid protein host organism:Mus musculus CBA

    Publication: 2580019;

  13. Monoclonal antibodies to scorpion toxins. Characterization and molecular mechanisms of neutralization.

    ID: 1585747

    Description: epitope description:K58 antigen name:Alpha-mammal toxin AaH2 host organism:Mus musculus BALB/c antibody name:4C1

    Publication: 2454259;

  14. Identification of a DTH-inducing T-cell epitope on the E2 membrane protein of Semliki Forest virus.

    ID: 1585749

    Description: epitope description:IQDTRNAVRACRIQYHHDPQPVGREKFTIRPHYGKEI antigen name:Structural polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2476243;

  15. Targeting of specific domains of diphtheria toxin by site-directed antibodies.

    ID: 1585824

    Description: epitope description:SESPNK antigen name:Diphtheria toxin (UniProt:H2GU79) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1282534;

  16. Antigenicity of peptide 19-28 of toxin II from the scorpion Androctonus australis as measured by different solid-phase tests and characterization of s...

    ID: 1585902

    Description: epitope description:NAYANEEATKL host organism:Oryctolagus cuniculus

    Publication: 2448919;

  17. Antigenicity of peptide 19-28 of toxin II from the scorpion Androctonus australis as measured by different solid-phase tests and characterization of s...

    ID: 1585905

    Description: epitope description:KLPDHVRTKG antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 2448919;

  18. Production of a recombinant human T-cell leukemia virus type-I trans-activator (tax1) antigen and its utilization for generation of monoclonal antibod...

    ID: 1586153

    Description: epitope description:EPQISPGGLEPPSEKHFRETEV antigen name:Protein Tax-1 host organism:Mus musculus BALB/c antibody name:TAXY-6, TAXY-8

    Publication: 1710610;

  19. Identification of T- and B-cell epitopes associated with a restricted component of the Epstein-Barr virus-induced early antigen complex.

    ID: 1586306

    Description: epitope description:GMLEASEGLDGWIHQ antigen name:Apoptosis regulator BHRF1 host organism:Homo sapiens

    Publication: 7678829;

  20. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586335

    Description: epitope description:AASKTAYEAKLAQYQADLA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  21. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586337

    Description: epitope description:TNAANQAAYQKALAAYQAE antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  22. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586346

    Description: epitope description:KATYEAAVAANNAKNAALT antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  23. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586350

    Description: epitope description:AIKKRNADAKADYEAKLAK antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  24. Structural and immunological characterization of Friend murine leukaemia virus glycopolypeptide using synthetic oligopeptides.

    ID: 1586354

    Description: epitope description:SPHQVYN antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus

    Publication: 6479153;

  25. Structural and immunological characterization of Friend murine leukaemia virus glycopolypeptide using synthetic oligopeptides.

    ID: 1586356

    Description: epitope description:SPHQVYN antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus

    Publication: 6479153;

  26. Structural and immunological characterization of Friend murine leukaemia virus glycopolypeptide using synthetic oligopeptides.

    ID: 1586367

    Description: epitope description:PKPAKSP antigen name:Envelope glycoprotein host organism:Oryctolagus cuniculus

    Publication: 6479153;

  27. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586605

    Description: epitope description:TYEAALKQYEADLAA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  28. An antigenic peptide inducing cross-reacting antibodies inhibiting the interaction of Streptococcus mutans PAc with human salivary components.

    ID: 1586643

    Description: epitope description:YQTELARVQKANADAKATY antigen name:UniProt:I6TX52 host organism:Mus musculus B10.D2

    Publication: 7591125;

  29. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587913

    Description: epitope description:KDSPVGELLTRSKYNQNSK antigen name:Other Clostridium botulinum protein host organism:Homo sapiens

    Publication: 18676021;

  30. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587921

    Description: epitope description:KKDEESTDEIGLIGIHRFY antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  31. Molecular recognition of botulinum neurotoxin B heavy chain by human antibodies from cervical dystonia patients that develop immunoresistance to toxin...

    ID: 1587924

    Description: epitope description:KRKPYNLKLGCNWQFIPKDEGWTE antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 18676021;

  32. Peptide vaccines incorporating a 'promiscuous' T-cell epitope bypass certain haplotype restricted immune responses and provide broad spectrum immunoge...

    ID: 1587945

    Description: epitope description:EGLLKKLLDTLENMLK host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7508238;

  33. Peptide vaccines incorporating a 'promiscuous' T-cell epitope bypass certain haplotype restricted immune responses and provide broad spectrum immunoge...

    ID: 1587985

    Description: epitope description:VDDALIDSTKIYSYFPSV antigen name:Tetanus toxin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7508238;

  34. Peptide vaccines incorporating a 'promiscuous' T-cell epitope bypass certain haplotype restricted immune responses and provide broad spectrum immunoge...

    ID: 1587986

    Description: epitope description:VDDALIDSTKIYSYFPSV antigen name:Tetanus toxin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7508238;

  35. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588016

    Description: epitope description:FHIQGQVYCDTC antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  36. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588018

    Description: epitope description:IQGQVYCDTCRA antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  37. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588019

    Description: epitope description:GQVYCDTCRAGF antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  38. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588035

    Description: epitope description:SEFIPGASLRLQ antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  39. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588038

    Description: epitope description:FIPGASLRLQCK antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  40. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588040

    Description: epitope description:PGASLRLQCKDK antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  41. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588043

    Description: epitope description:LRLQCKDKENGD antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  42. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588049

    Description: epitope description:DKENGDVTFTEV antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  43. Characterization of Mengo virus neutralization epitopes.

    ID: 1588053

    Description: epitope description:K212, K285 antigen name:Cardiovirus A protein host organism:Mus musculus BALB/c antibody name:mAB6

    Publication: 1704653;

  44. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588054

    Description: epitope description:ENGDVTFTEVGY antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  45. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588066

    Description: epitope description:TRAEGLYSMLVE antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  46. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588076

    Description: epitope description:MLVERDHKNEFC antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  47. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588077

    Description: epitope description:VERDHKNEFCEI antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  48. Epitopes of an influenza viral peptide recognized by antibody at single amino acid resolution.

    ID: 1588085

    Description: epitope description:NVPEKQT antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:1/1

    Publication: 2447184;

  49. Epitopes of an influenza viral peptide recognized by antibody at single amino acid resolution.

    ID: 1588086

    Description: epitope description:CPKYV antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 2447184;

  50. Epitopes of an influenza viral peptide recognized by antibody at single amino acid resolution.

    ID: 1588100

    Description: epitope description:GMRNV antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 2447184;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston