Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436160

    Description: epitope description:PRLKHEQSV host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  2. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436163

    Description: epitope description:HRGRAQ host organism:Equus caballus

    Publication: 10921846;

  3. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436166

    Description: epitope description:FTILRY host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  4. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436171

    Description: epitope description:TSMARYVRHSNYKHM host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  5. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436172

    Description: epitope description:MSPILDFPSRKTMKT host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  6. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera.

    ID: 1436174

    Description: epitope description:SCNDNKSVPCIVPQL host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  7. Serological specificity of phenolic glycolipid I from Mycobacterium leprae and use in serodiagnosis of leprosy.

    ID: 1436190

    Description: epitope description:phenolic phthiocerol antigen name:phenolic glycolipid-1 host organism:Oryctolagus cuniculus

    Publication: 6193065;

  8. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1436196

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;

  9. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1436205

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;

  10. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1436206

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston