Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473499

    Description: epitope description:NEYGVEGGRVNAVG antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  2. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473500

    Description: epitope description:GYGESRPVADN antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  3. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473501

    Description: epitope description:EIEAFGKRYFTDS antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  4. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473510

    Description: epitope description:KFDFDKSKVKENSY antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  5. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473511

    Description: epitope description:DVKFDFDKSKVKENSYADIKN antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  6. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473516

    Description: epitope description:MKQYPSTSTTVEGHT antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  7. Use of synthetic peptides to identify surface-exposed, linear B-cell epitopes within outer membrane protein F of Pseudomonas aeruginosa.

    ID: 1473528

    Description: epitope description:KFDFDKSKVKENSY antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 7580798;

  8. Synthetic peptides representing two protective, linear B-cell epitopes of outer membrane protein F of Pseudomonas aeruginosa elicit whole-cell-reactiv...

    ID: 1473535

    Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Rattus norvegicus antibody name:rat antibodies

    Publication: 7539410;

  9. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473541

    Description: epitope description:EKKGREREHEEEEEE antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  10. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473547

    Description: epitope description:ELKQCKHQCKVQRQY antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  11. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473548

    Description: epitope description:HEEEEEEWGTGGVDE antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  12. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473552

    Description: epitope description:CERQEGGQQKQLCRF antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  13. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473554

    Description: epitope description:CQERYKKERGQHNYK antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  14. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473565

    Description: epitope description:FVSWGRGTITKILEN antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  15. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473566

    Description: epitope description:ITKILENKRESINVR antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  16. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473567

    Description: epitope description:RESINVRQGDIVSIS antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  17. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473577

    Description: epitope description:LKTSKDTLEKLFEKQ antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  18. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473579

    Description: epitope description:QGTIMKASKEQIRAM antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  19. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473582

    Description: epitope description:GSFKLFKKDPSQSNK antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  20. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473584

    Description: epitope description:GQLFEAERIDYPPLE antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  21. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473587

    Description: epitope description:VPFYNSRATKIAIVV antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  22. Ana o 1, a cashew (Anacardium occidental) allergen of the vicilin seed storage protein family.

    ID: 1473594

    Description: epitope description:CFEVNAEGNIRYTLA antigen name:Ana 0 1 host organism:Homo sapiens antibody name:pooled human sera

    Publication: 12110836;

  23. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473606

    Description: epitope description:REGKEV antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  24. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473608

    Description: epitope description:EVLPGC antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  25. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473617

    Description: epitope description:PEVCKV antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  26. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473626

    Description: epitope description:CYGDWA antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  27. Molecular and immunological characterization and IgE epitope mapping of Pen n 18, a major allergen of Penicillium notatum.

    ID: 1473645

    Description: epitope description:TIPQGDADEDGNGHGTHCSGTIAGK antigen name:Pen ch 18 host organism:Homo sapiens antibody name:patient sera

    Publication: 11964171;

  28. A method for the detection of IgE binding sequences of allergens based on a modification of epitope mapping.

    ID: 1473646

    Description: epitope description:SWCDPATGYKVSALTGCRAMV antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 2474614;

  29. Molecular and immunological characterization and IgE epitope mapping of Pen n 18, a major allergen of Penicillium notatum.

    ID: 1473647

    Description: epitope description:GVDAYVIDTGANVKHVDFE antigen name:Pen ch 18 host organism:Homo sapiens antibody name:patient sera

    Publication: 11964171;

  30. Possible role for a human adenovirus in the pathogenesis of celiac disease.

    ID: 1473664

    Description: epitope description:FRPSQQN antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Rattus norvegicus

    Publication: 6491604;

  31. Cross-reactivity and epitope analysis of Pru a 1, the major cherry allergen.

    ID: 1473667

    Description: epitope description:S113 antigen name:Bet v 1 host organism:Mus musculus

    Publication: 10403481;

  32. Cross-reactivity and epitope analysis of Pru a 1, the major cherry allergen.

    ID: 1473672

    Description: epitope description:S113 antigen name:Pru av 1 host organism:Mus musculus

    Publication: 10403481;

  33. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473715

    Description: epitope description:QLCQMLGKIIAQQNQSRGKGPGKKNKKK antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;

  34. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473726

    Description: epitope description:MSAEDKALFRRCAAD antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  35. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473728

    Description: epitope description:RCAADYASRLHSVLG antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  36. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473729

    Description: epitope description:YASRLHSVLGTANAP antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  37. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473731

    Description: epitope description:TANAPLSIYEAIKGV antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  38. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473738

    Description: epitope description:ALKLMEKREYKFACQ antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  39. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473739

    Description: epitope description:EKREYKFACQTFLKD antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  40. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473747

    Description: epitope description:AQMHSNNGPQIGSAV antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  41. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473753

    Description: epitope description:VWDVDYSAFDANHCS antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  42. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473758

    Description: epitope description:FRTEFGFHPNAEWIL antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  43. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473768

    Description: epitope description:RHYEGVELDTYTMIS antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  44. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473771

    Description: epitope description:YGDDIVVASDYDLDF antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  45. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473775

    Description: epitope description:HFKSLGQTITPADKS antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  46. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473782

    Description: epitope description:ILSFARRGTIQEKLI antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  47. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473783

    Description: epitope description:RRGTIQEKLISVAGL antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  48. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473784

    Description: epitope description:QEKLISVAGLAVHSG antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  49. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473785

    Description: epitope description:SVAGLAVHSGPDEYR antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  50. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473787

    Description: epitope description:PDEYRRLFEPFQGLF antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  51. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473797

    Description: epitope description:MEPDTAPGLPWALQG antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  52. Identification of a major antibody binding epitope in the non-structural protein 3D of foot-and-mouth disease virus in cattle and the development of a...

    ID: 1473800

    Description: epitope description:PEVEAALKLMEKREY antigen name:Polyprotein host organism:Bos taurus antibody name:bovine serum

    Publication: 17320098;

  53. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473872

    Description: epitope description:GQAKKKKPEKPHFPLAAEDDIRHHLTQT antigen name:Nucleoprotein host organism:Mus musculus antibody name:1BD11, 1CA7 and 1CH5

    Publication: 16426684;

  54. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473873

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Mus musculus antibody name:1BD11, 1CA7 and 1CH5

    Publication: 16426684;

  55. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473882

    Description: epitope description:KPEKPHFPLAAEDDIRHHLTQTERSLCLQSIQTAFNQGAGTASL antigen name:Nucleoprotein host organism:Mus musculus antibody name:1BD11

    Publication: 16426684;

  56. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473894

    Description: epitope description:KPEKPHFPLAAEDDIRHHLTQTERSLCLQSIQTAFNQGAGTASL antigen name:Nucleoprotein host organism:Mus musculus antibody name:SR30

    Publication: 16426684;

  57. Identification and diagnostic value of a major antibody epitope on the 12 kDa antigen from Echinococcus granulosus (hydatid disease) cyst fluid.

    ID: 1472497

    Description: epitope description:QKVVDLLKELEEVFQLLRKK antigen name:AntigenB host organism:Homo sapiens antibody name:Human sera

    Publication: 7517028;

  58. Eimeria tenella: B-cell epitope mapping following primary and secondary infections.

    ID: 1472501

    Description: epitope description:GGEQVP antigen name:Microneme protein 4 host organism:Gallus gallus Cobb 500

    Publication: 16510143;

  59. Direct evaluation of the immunodominance of a major antigenic site of foot-and-mouth disease virus in a natural host.

    ID: 1472833

    Description: epitope description:ASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Sus scrofa Landrace X Large White antibody name:Swine sera

    Publication: 7831785;

  60. Eimeria tenella: B-cell epitope mapping following primary and secondary infections.

    ID: 1472504

    Description: epitope description:AGAGGA antigen name:Microneme protein 4 host organism:Gallus gallus Cobb 500

    Publication: 16510143;

  61. Relative immunogenicity and efficacy of two synthetic chimeric peptides of fimbrin as vaccinogens against nasopharyngeal colonization by nontypeable H...

    ID: 1472509

    Description: epitope description:RSDYKFYEDANGTRDHKKG antigen name:Outer membrane protein A (3aII*Gd) host organism:Chinchilla lanigera antibody name:chinchilla ant...

    Publication: 9261941;

  62. Relative immunogenicity and efficacy of two synthetic chimeric peptides of fimbrin as vaccinogens against nasopharyngeal colonization by nontypeable H...

    ID: 1472515

    Description: epitope description:YQWLTRVGKYRPQDKPNT antigen name:Outer membrane protein A (3aII*Gd) host organism:Chinchilla lanigera antibody name:chinchilla anti...

    Publication: 9261941;

  63. Relative immunogenicity and efficacy of two synthetic chimeric peptides of fimbrin as vaccinogens against nasopharyngeal colonization by nontypeable H...

    ID: 1472524

    Description: epitope description:RSDYKFYEDANGTRDHKKG antigen name:Outer membrane protein A (3aII*Gd) host organism:Chinchilla lanigera antibody name:chinchilla ant...

    Publication: 9261941;

  64. A P5 peptide that is homologous to peptide 10 of OprF from Pseudomonas aeruginosa enhances clearance of nontypeable Haemophilus influenzae from acutel...

    ID: 1472628

    Description: epitope description:SFHDGINNNGAIK antigen name:Outer membrane protein A (3aII*Gd) host organism:Rattus norvegicus antibody name:rat BAL fluid

    Publication: 10603411;

  65. Protective immunity induced by phage displayed mitochondrial related peptides of Schistosoma japonicum.

    ID: 1472669

    Description: epitope description:RKNPQRSTLRIN host organism:Oryctolagus cuniculus New Zealand White antibody name:Affinity-purified anti-Sj338

    Publication: 16999929;

  66. Protective immunity induced by phage displayed mitochondrial related peptides of Schistosoma japonicum.

    ID: 1472679

    Description: epitope description:KSTQRSTRRNLS host organism:Mus musculus BALB/c

    Publication: 16999929;

  67. Improvement of binding of Puumala virus neutralization site resembling peptide with a second-generation phage library.

    ID: 1472687

    Description: epitope description:YWERGIPLP host organism:Homo sapiens antibody name:mAb 1C9

    Publication: 12874378;

  68. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472700

    Description: epitope description:MNPLFVLMLAAVTFA antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  69. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472732

    Description: epitope description:VLMLAAVTFASFDVP antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  70. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472734

    Description: epitope description:SFDVPSKQPTIDIDL antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  71. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472735

    Description: epitope description:SKQPTIDIDLCDICT antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  72. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472742

    Description: epitope description:YLVKYLCKIARSQDA antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  73. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472746

    Description: epitope description:QQEVDYIIDHVDQHN antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  74. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472749

    Description: epitope description:VLMLAAVTFASFDVP antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  75. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472750

    Description: epitope description:EEHIGYLVKYLCKIA antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  76. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472753

    Description: epitope description:SFDVPSKQPTIDIDL antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  77. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472757

    Description: epitope description:NTMDVIKKMLADQTV antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  78. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472758

    Description: epitope description:IKKMLADQTVEEHIG antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  79. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472761

    Description: epitope description:RSQDACIEFVQQEVD antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  80. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472764

    Description: epitope description:YIIDHVDQHNATEIC antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  81. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472765

    Description: epitope description:VDQHNATEICRLIKLC antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  82. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472768

    Description: epitope description:SFDVPSKQPTIDIDL antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Mus musculus Swiss

    Publication: 16861685;

  83. Two novel types of O-glycans on the mugwort pollen allergen Art v 1 and their role in antibody binding.

    ID: 1472790

    Description: epitope description:alpha-L-arabinofuranose antigen name:Art v 1 host organism:Homo sapiens

    Publication: 15591314;

  84. Mapping of B-cell epitopes on a novel 11.5-kilodalton Fasciola hepatica-Schistosoma mansoni cross-reactive antigen belonging to a member of the F. hep...

    ID: 1472799

    Description: epitope description:CDICTNTMDVIKKML antigen name:Other Fasciola hepatica (liver fluke) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16861685;

  85. Direct evaluation of the immunodominance of a major antigenic site of foot-and-mouth disease virus in a natural host.

    ID: 1472838

    Description: epitope description:YTASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Sus scrofa Landrace X Large White antibody name:Swine sera

    Publication: 7831785;

  86. Direct evaluation of the immunodominance of a major antigenic site of foot-and-mouth disease virus in a natural host.

    ID: 1472879

    Description: epitope description:ASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Mus musculus BALB/c antibody name:mAb SD6

    Publication: 7831785;

  87. Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

    ID: 1472892

    Description: epitope description:DKCPDTPANVTVDAN antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 1379985;

  88. Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

    ID: 1472893

    Description: epitope description:KFDFDKSKVKENSY antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 1379985;

  89. Mutational analysis of the IgE-binding epitopes of P34/Gly m Bd 30K.

    ID: 1472923

    Description: epitope description:PQEFSKKTYQ antigen name:Hydrophobic seed protein host organism:Homo sapiens

    Publication: 10669862;

  90. Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

    ID: 1472927

    Description: epitope description:RGTYETGNKKVHGN antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 1379985;

  91. Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

    ID: 1472930

    Description: epitope description:SDSDNDGVCDNVDK antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 1379985;

  92. Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

    ID: 1472937

    Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 1379985;

  93. Direct evaluation of the immunodominance of a major antigenic site of foot-and-mouth disease virus in a natural host.

    ID: 1472943

    Description: epitope description:ASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Sus scrofa Landrace X Large White

    Publication: 7831785;

  94. A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

    ID: 1472944

    Description: epitope description:GGPIPTIPRPTL host organism:Oryctolagus cuniculus antibody name:anti-Gb3

    Publication: 16713681;

  95. A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

    ID: 1472949

    Description: epitope description:FQWSWYTPPRPS host organism:Oryctolagus cuniculus antibody name:anti-Gb3

    Publication: 16713681;

  96. A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

    ID: 1472951

    Description: epitope description:EQWPWSLLPIHY host organism:Oryctolagus cuniculus antibody name:anti-Gb3

    Publication: 16713681;

  97. A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

    ID: 1472957

    Description: epitope description:WHWTWLSEYPPP host organism:Oryctolagus cuniculus antibody name:anti-Gb3

    Publication: 16713681;

  98. Conjugates of synthetic cyclic peptides elicit bactericidal antibodies against a conformational epitope on a class 1 outer membrane protein of Neisser...

    ID: 1472986

    Description: epitope description:YTKDTNNNL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 7543883;

  99. Characterization of monoclonal antibodies generated against Norwalk virus GII capsid protein expressed in Escherichia coli.

    ID: 1472995

    Description: epitope description:EAKVDTTAGRFTPKLGSLEISTESSDFDQNQPTRFTPVGIG antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:MAb 4D2

    Publication: 11145271;

  100. Analysis of the immune response against mixotope peptide libraries from a main antigenic site of foot-and-mouth disease virus.

    ID: 1473011

    Description: epitope description:TTYTASARGDLAHPTTTHARHL host organism:Cavia porcellus Duncan-Hartley antibody name:Guinea pig sera

    Publication: 15780448;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston