Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422434

    Description: epitope description:SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cunicu...

    Publication: 7506298;

  2. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422436

    Description: epitope description:REFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand Whit...

    Publication: 7506298;

  3. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422437

    Description: epitope description:SELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus New Zealand White antibody name:Rabb...

    Publication: 7506298;

  4. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1422439

    Description: epitope description:SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/...

    Publication: 7506298;

  5. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423405

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  6. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423414

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  7. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423416

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  8. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423434

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  9. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423435

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  10. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423437

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  11. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423449

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  12. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423455

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  13. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423457

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  14. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423465

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  15. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423466

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  16. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423478

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  17. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423482

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  18. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423490

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  19. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423500

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  20. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423507

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  21. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423509

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  22. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423512

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  23. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423513

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  24. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423516

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  25. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423518

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  26. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423525

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  27. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423531

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  28. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423533

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  29. Immunodominant epitopes of the adhesin of Mycoplasma pneumoniae.

    ID: 1423534

    Description: epitope description:LDQVLDYV antigen name:Adhesin P1 host organism:Homo sapiens antibody name:Human sera

    Publication: 1696281;

  30. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415484

    Description: epitope description:TASVTSPLTTNQTM antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  31. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415489

    Description: epitope description:VATHLAGPQSSSAF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  32. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415496

    Description: epitope description:IMGGECPTAEDMVN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  33. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415501

    Description: epitope description:ALLSSLTVTSLLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  34. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415502

    Description: epitope description:ALLSSLTVTSLLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  35. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415504

    Description: epitope description:ALLSSLTVTSLLRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  36. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415508

    Description: epitope description:RRLHQWINEDYPSP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  37. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415509

    Description: epitope description:RRLHQWINEDYPSP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  38. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415512

    Description: epitope description:EDYPSP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  39. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415514

    Description: epitope description:EDYPSP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  40. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415516

    Description: epitope description:DWVCSVLADFKAWL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  41. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415517

    Description: epitope description:DWVCSVLADFKAWL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  42. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415531

    Description: epitope description:AITGHVKNGSMRLA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  43. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415536

    Description: epitope description:RLAGPRTCANMWHG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  44. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415544

    Description: epitope description:INEYTTGPSTPCPS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  45. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415546

    Description: epitope description:PNYTRALWRVAANS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  46. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415555

    Description: epitope description:EVRRVGDFHYITGA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  47. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415580

    Description: epitope description:FEPLRAETDDVEPS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  48. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415581

    Description: epitope description:RAETDDVEPSVAAEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  49. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415585

    Description: epitope description:RAETDDVEPSVAAEC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  50. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415587

    Description: epitope description:CFKKPPKYPPALPI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston