Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

    ID: 1472930

    Description: epitope description:SDSDNDGVCDNVDK antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 1379985;

  2. Synthetic peptides representing epitopes of outer membrane protein F of Pseudomonas aeruginosa that elicit antibodies reactive with whole cells of het...

    ID: 1472937

    Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus ICR antibody name:mouse serum

    Publication: 1379985;

  3. Direct evaluation of the immunodominance of a major antigenic site of foot-and-mouth disease virus in a natural host.

    ID: 1472943

    Description: epitope description:ASARGDLAHLTTTHARHLP antigen name:Polyprotein host organism:Sus scrofa Landrace X Large White

    Publication: 7831785;

  4. A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

    ID: 1472944

    Description: epitope description:GGPIPTIPRPTL host organism:Oryctolagus cuniculus antibody name:anti-Gb3

    Publication: 16713681;

  5. A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

    ID: 1472949

    Description: epitope description:FQWSWYTPPRPS host organism:Oryctolagus cuniculus antibody name:anti-Gb3

    Publication: 16713681;

  6. A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

    ID: 1472951

    Description: epitope description:EQWPWSLLPIHY host organism:Oryctolagus cuniculus antibody name:anti-Gb3

    Publication: 16713681;

  7. A globotriaosylceramide (Gb3Cer) mimic peptide isolated from phage display library expressed strong neutralization to Shiga toxins.

    ID: 1472957

    Description: epitope description:WHWTWLSEYPPP host organism:Oryctolagus cuniculus antibody name:anti-Gb3

    Publication: 16713681;

  8. Conjugates of synthetic cyclic peptides elicit bactericidal antibodies against a conformational epitope on a class 1 outer membrane protein of Neisser...

    ID: 1472986

    Description: epitope description:YTKDTNNNL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 7543883;

  9. Characterization of monoclonal antibodies generated against Norwalk virus GII capsid protein expressed in Escherichia coli.

    ID: 1472995

    Description: epitope description:EAKVDTTAGRFTPKLGSLEISTESSDFDQNQPTRFTPVGIG antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:MAb 4D2

    Publication: 11145271;

  10. Analysis of the immune response against mixotope peptide libraries from a main antigenic site of foot-and-mouth disease virus.

    ID: 1473011

    Description: epitope description:TTYTASARGDLAHPTTTHARHL host organism:Cavia porcellus Duncan-Hartley antibody name:Guinea pig sera

    Publication: 15780448;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston