Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588109

    Description: epitope description:NEFCEITLISSG antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  2. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588112

    Description: epitope description:EITLISSGRKDC antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  3. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588116

    Description: epitope description:ISSGRKDCNEIP antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  4. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588122

    Description: epitope description:DCNEIPTEGWVK antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  5. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588135

    Description: epitope description:PSLKFILNTVNG antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  6. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588138

    Description: epitope description:FILNTVNGTTRT antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  7. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588139

    Description: epitope description:FILNTVNGTTRT antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 15941589;

  8. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588160

    Description: epitope description:ALPKCAQVYNKL antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  9. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588183

    Description: epitope description:DKENGDVTFTEVGYTRAEGLYSMLVERDHKNE antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  10. Analysis of IgE and IgG B-cell immunodominant regions of Ole e 1, the main allergen from olive pollen.

    ID: 1588190

    Description: epitope description:EDVPQPPVSQFHIQGQVYCDTCRAG antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 15941589;

  11. Limitations of different ELISA procedures for localizing epitopes in viral coat protein subunits.

    ID: 1588196

    Description: epitope description:RGTGSYNRSSFES antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:57P, 174P

    Publication: 2473721;

  12. Limitations of different ELISA procedures for localizing epitopes in viral coat protein subunits.

    ID: 1588198

    Description: epitope description:DDATVAIRSAINNLIVELIR antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:161P

    Publication: 2473721;

  13. Limitations of different ELISA procedures for localizing epitopes in viral coat protein subunits.

    ID: 1588200

    Description: epitope description:RNRIIEVENQANPTTAETLDATRRVDDA antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:121P

    Publication: 2473721;

  14. Limitations of different ELISA procedures for localizing epitopes in viral coat protein subunits.

    ID: 1588204

    Description: epitope description:LDPLVTALLGAFD antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:270P

    Publication: 2473721;

  15. Characteristics and location of cross-reactive and serotype-specific neutralization sites on VP7 of human G type 9 rotaviruses.

    ID: 1588209

    Description: epitope description:T91 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:F45:6

    Publication: 8395127;

  16. Mapping of immunogenic regions of human T cell leukemia virus type I (HTLV-I) gp46 and gp21 envelope glycoproteins with env-encoded synthetic peptides...

    ID: 1588224

    Description: epitope description:LLPHSNLDHILEPSIPWKSK antigen name:Envelope glycoprotein gp62 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2563272;

  17. Characteristics and location of cross-reactive and serotype-specific neutralization sites on VP7 of human G type 9 rotaviruses.

    ID: 1588237

    Description: epitope description:A213 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:F45:1

    Publication: 8395127;

  18. Characteristics and location of cross-reactive and serotype-specific neutralization sites on VP7 of human G type 9 rotaviruses.

    ID: 1588246

    Description: epitope description:T242 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:F45:2

    Publication: 8395127;

  19. Human rotavirus VP4 contains strain-specific, serotype-specific and cross-reactive neutralization sites.

    ID: 1588307

    Description: epitope description:S397 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:ST-3:3

    Publication: 8645097;

  20. T and B epitope determination and analysis of multiple antigenic peptides for the Schistosoma mansoni experimental vaccine triose-phosphate isomerase.

    ID: 1588397

    Description: epitope description:EVCVRQLKAIANK antigen name:Triosephosphate isomerase host organism:Mus musculus BALB/c

    Publication: 7504709;

  21. Production and epitopic characterization of monoclonal antibodies against bovine beta-lactoglobulin.

    ID: 1588521

    Description: epitope description:SLAMAASDISLLDAQSAPLR antigen name:Bos d 5 host organism:Mus musculus BALB/c antibody name:102, 129

    Publication: 9313138;

  22. A novel and sensitive method for the detection of T cell stimulatory epitopes of alpha/beta- and gamma-gliadin.

    ID: 1588538

    Description: epitope description:QPFPQPQLPYP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus BALB/c antibody n...

    Publication: 15306583;

  23. A novel and sensitive method for the detection of T cell stimulatory epitopes of alpha/beta- and gamma-gliadin.

    ID: 1588539

    Description: epitope description:QPFPQPQLPYP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus BALB/c antibody n...

    Publication: 15306583;

  24. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588565

    Description: epitope description:TMEHVSSSEE antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  25. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588568

    Description: epitope description:SSEESIISQE antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  26. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588572

    Description: epitope description:QETYKQEKNM antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  27. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588584

    Description: epitope description:KEVVRNANEE antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  28. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588624

    Description: epitope description:EYSIGSSSEE antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  29. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588625

    Description: epitope description:SIGSSSEESA antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  30. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588648

    Description: epitope description:ITVDDKHYQK antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  31. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588652

    Description: epitope description:QKALNEINQF antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  32. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588665

    Description: epitope description:NEINQFYQKF antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  33. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588670

    Description: epitope description:PQYLQYLYQG antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  34. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588682

    Description: epitope description:NPWDQVKRNA antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  35. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588684

    Description: epitope description:QVKRNAVPIT antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  36. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588694

    Description: epitope description:LNREQLSTSE antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  37. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588696

    Description: epitope description:QLSTSEENSK antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  38. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588699

    Description: epitope description:ENSKKTVDME antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  39. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588708

    Description: epitope description:TKLTEEEKNR antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  40. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588709

    Description: epitope description:LTEEEKNRLN antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  41. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588716

    Description: epitope description:KKISQRYQKF antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  42. Identification of sequential IgE-binding epitopes on bovine alpha(s2)-casein in cow's milk allergic patients.

    ID: 1588723

    Description: epitope description:YLKTVYQHQK antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 12373003;

  43. Modulating the immunological properties of a linear B-cell epitope by insertion into permissive sites of the MalE protein.

    ID: 1582460

    Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 9171894;

  44. A novel mimetic antigen eliciting protective antibody to Neisseria meningitidis.

    ID: 1582488

    Description: epitope description:AFQTPVHS antigen name:Putative membrane-bound lytic murein transglycosylase A host organism:Mus musculus CD1 antibody name:mAb 25

    Publication: 11714816;

  45. A novel mimetic antigen eliciting protective antibody to Neisseria meningitidis.

    ID: 1582492

    Description: epitope description:AFQTPVHS antigen name:Putative membrane-bound lytic murein transglycosylase A host organism:Mus musculus CD1 antibody name:mAb 25

    Publication: 11714816;

  46. A novel mimetic antigen eliciting protective antibody to Neisseria meningitidis.

    ID: 1582496

    Description: epitope description:AHFVQQTP antigen name:Major outer membrane protein P.IA host organism:Mus musculus CD1 antibody name:mAb 25

    Publication: 11714816;

  47. Pilot study of diagnostic potential of the Mycobacterium tuberculosis recombinant HBHA protein in a vaccinated population in Finland.

    ID: 1582541

    Description: epitope description:IELPKKAAPAKKAAP + METH(K167) antigen name:Heparin-binding hemagglutinin host organism:Homo sapiens

    Publication: 18815611;

  48. Pilot study of diagnostic potential of the Mycobacterium tuberculosis recombinant HBHA protein in a vaccinated population in Finland.

    ID: 1582593

    Description: epitope description:RTDTRSRVEESRARL antigen name:Heparin-binding hemagglutinin host organism:Homo sapiens

    Publication: 18815611;

  49. Pilot study of diagnostic potential of the Mycobacterium tuberculosis recombinant HBHA protein in a vaccinated population in Finland.

    ID: 1582610

    Description: epitope description:RAVGERAAKLVGIEL antigen name:Heparin-binding hemagglutinin host organism:Homo sapiens

    Publication: 18815611;

  50. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582626

    Description: epitope description:TTLNPTI antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston