Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582636

    Description: epitope description:VAGLQN host organism:Mus musculus C57BL/10

    Publication: 7518628;

  2. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582637

    Description: epitope description:AGLQND host organism:Mus musculus C57BL/10

    Publication: 7518628;

  3. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582644

    Description: epitope description:TTNVAR host organism:Mus musculus C57BL/10

    Publication: 7518628;

  4. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582646

    Description: epitope description:SATAIF antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  5. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582648

    Description: epitope description:TAIFDT antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  6. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582651

    Description: epitope description:FDTTTL antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  7. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582658

    Description: epitope description:PTIAGA antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  8. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582660

    Description: epitope description:IAGAGD antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  9. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582661

    Description: epitope description:AGAGDV antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  10. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582668

    Description: epitope description:ASAEGQ antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  11. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582670

    Description: epitope description:AEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus C57BL/10

    Publication: 7518628;

  12. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582672

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  13. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582676

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  14. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582680

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  15. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582683

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  16. Analysis of the humoral response elicited in mice by a chimeric peptide representing variable segments I and IV of the major outer membrane protein of...

    ID: 1582696

    Description: epitope description:CSATAIFDTTTLNPTIAGAGDVKASACAAPTTSDVAGLQNDPTTNVA host organism:Mus musculus C57BL/10

    Publication: 7518628;

  17. Epitope mapping of antibodies recognising the N-terminal domain of simian virus large tumour antigen.

    ID: 1582770

    Description: epitope description:TEIPTYGTDEWEQWW antigen name:Macaca mulatta polyomavirus 1 protein host organism:Mus musculus BALB/c antibody name:pAb 211, pAb 22...

    Publication: 9705560;

  18. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583400

    Description: epitope description:SDSNLKDLTF antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  19. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583422

    Description: epitope description:EKVTIQNWFR antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  20. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583425

    Description: epitope description:TIQNWFREAD antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  21. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583431

    Description: epitope description:READFAKEVP antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  22. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583432

    Description: epitope description:READFAKEVP antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  23. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583445

    Description: epitope description:KATKDEKIEE antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  24. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583459

    Description: epitope description:GERITSKQVD antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  25. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583467

    Description: epitope description:DDLIAKGNGK antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  26. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583471

    Description: epitope description:IAKGNGKITQ antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  27. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583472

    Description: epitope description:IAKGNGKITQ antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  28. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583474

    Description: epitope description:GNGKITQDEL antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  29. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583477

    Description: epitope description:KITQDELSKV antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  30. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583478

    Description: epitope description:KITQDELSKV antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  31. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583481

    Description: epitope description:QDELSKVVDN antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  32. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583484

    Description: epitope description:LSKVVDNYEL antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  33. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583501

    Description: epitope description:NSLDKLISSV antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  34. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583509

    Description: epitope description:VSAFTSSNDS antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  35. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583518

    Description: epitope description:SRNVLVAPTS antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  36. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583521

    Description: epitope description:VLVAPTSMLD antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:lamb sera

    Publication: 8828217;

  37. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583523

    Description: epitope description:VLVAPTSMLD antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  38. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583526

    Description: epitope description:APTSMLDQSL antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  39. Characterization of epitopes involved in the neutralization of Pasteurella haemolytica serotype A1 leukotoxin.

    ID: 1583535

    Description: epitope description:LSSLQFARAA antigen name:UniProt:S5PK59 host organism:Ovis aries antibody name:Sheep serum

    Publication: 8828217;

  40. Accessibility of three continuous epitopes in tomato bushy stunt virus.

    ID: 1583571

    Description: epitope description:GALRNYIGESSPA antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 3207502;

  41. Accessibility of three continuous epitopes in tomato bushy stunt virus.

    ID: 1583573

    Description: epitope description:GALRNYIGESSPA antigen name:Capsid protein host organism:Oryctolagus cuniculus

    Publication: 3207502;

  42. Characterization of dengue virus complex-specific neutralizing epitopes on envelope protein domain III of dengue 2 virus.

    ID: 1583643

    Description: epitope description:K310, P332, W391 antigen name:Genome polyprotein host organism:Mus musculus antibody name:MDVP-55A

    Publication: 18562544;

  43. Characterization of dengue virus complex-specific neutralizing epitopes on envelope protein domain III of dengue 2 virus.

    ID: 1583644

    Description: epitope description:K310, P332, W391 antigen name:Genome polyprotein host organism:Mus musculus antibody name:MDVP-55A

    Publication: 18562544;

  44. Immunization with a peptide having both T cell and conformationally restricted B cell epitopes elicits neutralizing antisera against a snake neurotoxi...

    ID: 1583650

    Description: epitope description:CYKKVWRDHRGTIIERGC antigen name:Naja nigricollis (black-necked spitting cobra) protein host organism:Mus musculus BALB/c

    Publication: 1701784;

  45. Immunization with a peptide having both T cell and conformationally restricted B cell epitopes elicits neutralizing antisera against a snake neurotoxi...

    ID: 1583654

    Description: epitope description:CYKKVWRDHRGTIIERGC antigen name:Naja nigricollis (black-necked spitting cobra) protein host organism:Mus musculus BALB/c

    Publication: 1701784;

  46. Topology of outer membrane pore protein PhoE of Escherichia coli. Identification of cell surface-exposed amino acids with the aid of monoclonal antibo...

    ID: 1583721

    Description: epitope description:R222, G296 antigen name:Outer membrane pore protein E host organism:Mus musculus BALB/c antibody name:PP1-2, PP1-3, PP1-5, PP3-1, ...

    Publication: 3528150;

  47. The orientation of the adenovirus fiber and its anchor domain identified through molecular mimicry.

    ID: 1583773

    Description: epitope description:YNKRFPGFVSP antigen name:Other Human mastadenovirus C protein host organism:Oryctolagus cuniculus

    Publication: 2462763;

  48. A novel approach for localization of the continuous protein antigenic sites by comprehensive synthetic surface scanning: antibody and T-cell activity ...

    ID: 1583788

    Description: epitope description:GTLVKTITDDQIEV antigen name:Hemagglutinin host organism:Mus musculus

    Publication: 6085322;

  49. A novel approach for localization of the continuous protein antigenic sites by comprehensive synthetic surface scanning: antibody and T-cell activity ...

    ID: 1583804

    Description: epitope description:HHPSTNQEQTSLYVQAS antigen name:Hemagglutinin host organism:Homo sapiens

    Publication: 6085322;

  50. A novel approach for localization of the continuous protein antigenic sites by comprehensive synthetic surface scanning: antibody and T-cell activity ...

    ID: 1583810

    Description: epitope description:APIDTGISEGITPNGSI host organism:Mus musculus

    Publication: 6085322;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston