Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8695

    Description: epitope description:VNGENLVGDDVVLAT antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  2. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1575

    Description: epitope description:EVAKNLNESLIDLQELG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  3. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1584

    Description: epitope description:PWYVWLGFIAGLIAIVM antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  4. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1590

    Description: epitope description:MVTILLCCMTSCCSCLK antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15356154;

  5. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1594

    Description: epitope description:CMTSCCSCLKGACSCGS antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  6. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1595

    Description: epitope description:LKGACSCGSCCKFDEDD antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15356154;

  7. Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

    ID: 1600

    Description: epitope description:DDSEPVLKGVKLHYT antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15356154;

  8. Generation and characterization of anti-leptin antisera against synthetic peptides and recombinant protein.

    ID: 1602

    Description: epitope description:AASKSCPLPQVRALESLESL antigen name:Leptin host organism:Oryctolagus cuniculus Japanese white antibody name:anti-peptide 91-110

    Publication: 15647625;

  9. Computational peptide dissection of Melan-a/MART-1 oncoprotein antigenicity.

    ID: 1625

    Description: epitope description:PAYEKL antigen name:Melanoma antigen recognized by T-cells 1 host organism:Mus musculus antibody name:mAb-1

    Publication: 15501517;

  10. Plasmodium falciparum merozoite surface protein 6 displays multiple targets for naturally occurring antibodies that mediate monocyte-dependent parasit...

    ID: 1660

    Description: epitope description:EEEKKEEKKEEKKPDNEITNEVKEEQKYSSPSDINAQNLISN antigen name:Merozoite surface protein 6 host organism:Homo sapiens

    Publication: 15664972;

  11. The primary GP5 neutralization epitope of North American isolates of porcine reproductive and respiratory syndrome virus.

    ID: 1735

    Description: epitope description:SSHLQLIYNLTLTLCELNGTDWLAN antigen name:Other Porcine reproductive and respiratory syndrome virus protein host organism:Mus musculu...

    Publication: 15507310;

  12. Integrin beta3 regions controlling binding of murine mAb 7E3: implications for the mechanism of integrin alphaIIbbeta3 activation.

    ID: 1994

    Description: epitope description:W155, S156, I157, Q158, N159, C203, Y204, D205, M206, K207, T208, T209, C210 antigen name:Integrin beta-3 host organism:Mus muscul...

    Publication: 15277669;

  13. Crystal structure of a Fab complex formed with PfMSP1-19, the C-terminal fragment of merozoite surface protein 1 from Plasmodium falciparum: a malaria...

    ID: 2054

    Description: epitope description:V1533, K1534, K1535, Q1536, P1538, Q1539, D1548, E1549, R1550, E1551, C1553, G1563, D1564 antigen name:Merozoite surface protein 1...

    Publication: 12729744;

  14. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 2065

    Description: epitope description:MTEQQWNFAGIEAAAS antigen name:6 kDa early secretory antigenic target host organism:Homo sapiens antibody name:Human sera

    Publication: 15325505;

  15. High epitope density in a single protein molecule significantly enhances antigenicity as well as immunogenicity: a novel strategy for modern vaccine d...

    ID: 2125

    Description: epitope description:SLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15627976;

  16. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 2143

    Description: epitope description:AAASAIQGNVTSIHSL antigen name:6 kDa early secretory antigenic target host organism:Homo sapiens

    Publication: 15325505;

  17. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 2152

    Description: epitope description:NVTSIHSLLDEGKQSL antigen name:6 kDa early secretory antigenic target host organism:Homo sapiens

    Publication: 15325505;

  18. Response of IFN-gamma and IgG to ESAT-6 and 38 kDa recombinant proteins and their peptides from Mycobacterium tuberculosis in tuberculosis patients an...

    ID: 2157

    Description: epitope description:LDEGKQSLTKLAAAWG antigen name:6 kDa early secretory antigenic target host organism:Homo sapiens

    Publication: 15325505;

  19. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 2955

    Description: epitope description:VELLSFLPSDFF antigen name:Capsid protein host organism:Homo sapiens

    Publication: 15589316;

  20. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 2967

    Description: epitope description:PSVRDLLDTASA antigen name:Capsid protein host organism:Mus musculus BALB/c

    Publication: 15589316;

  21. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 2974

    Description: epitope description:LDTASALYREAL antigen name:Capsid protein host organism:Homo sapiens

    Publication: 15589316;

  22. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 3016

    Description: epitope description:CWGELMTLATWV antigen name:Capsid protein host organism:Homo sapiens

    Publication: 15589316;

  23. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 3064

    Description: epitope description:TFGRETVLEYLV antigen name:Capsid protein host organism:Homo sapiens

    Publication: 15589316;

  24. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 3069

    Description: epitope description:VLEYLVSFGVWI antigen name:Capsid protein host organism:Mus musculus BALB/c

    Publication: 15589316;

  25. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 3088

    Description: epitope description:RPPNAPILSTLP antigen name:Capsid protein host organism:Mus musculus BALB/c

    Publication: 15589316;

  26. Immunological characterization of two hepatitis B core antigen variants and their immunoenhancing effect on co-delivered hepatitis B surface antigen.

    ID: 3107

    Description: epitope description:RRGRSPRRRTPS antigen name:Capsid protein host organism:Homo sapiens

    Publication: 15589316;

  27. Structural investigation of Borrelia burgdorferi OspB, a bactericidal Fab target.

    ID: 3294

    Description: epitope description:G231, S232, N233, A250, D251, S252, K253, K254, N272, T273, A274, G275, T276 antigen name:Outer surface protein B host organism:Mu...

    Publication: 15713683;

  28. The structure of a complex between the NC10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the NC41 an...

    ID: 3298

    Description: epitope description:P330, N331, D332, P333, T334, Y342, G344, N345, I367, I369, A370, S371, S373, N400, T401, W403 antigen name:Neuraminidase host org...

    Publication: 7994573;

  29. Epitope specificity of monoclonal antibodies to the N-protein of porcine reproductive and respiratory syndrome virus determined by ELISA with syntheti...

    ID: 3544

    Description: epitope description:VNQLCQLLGAMIKSQRQQPRGGQAKKKK antigen name:Nucleoprotein host organism:Sus scrofa

    Publication: 15661331;

  30. A novel site contributing to growth-arrest-specific gene 6 binding to its receptors as revealed by a human monoclonal antibody.

    ID: 3576

    Description: epitope description:IAVAGDLFQPER antigen name:Growth arrest-specific protein 6 host organism:Mus musculus (CBA/J X C57BL/6J) human IgH Tg human IgL Tg...

    Publication: 15579134;

  31. Identification of the epitope of a monoclonal antibody to DJ-1.

    ID: 3577

    Description: epitope description:ASLEDAKKEGPYDVVVLPGGNLG antigen name:Protein deglycase DJ-1 host organism:Mus musculus antibody name:3E8

    Publication: 15663963;

  32. Identification of the epitope of a monoclonal antibody to DJ-1.

    ID: 3578

    Description: epitope description:ASLEDAKKEGPYDVVVLPGGNLG antigen name:Protein deglycase DJ-1 host organism:Mus musculus antibody name:3E8

    Publication: 15663963;

  33. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4128

    Description: epitope description:STQSNPKPRI antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  34. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4129

    Description: epitope description:VAIGDQILDL antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  35. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4133

    Description: epitope description:FDETTLNNFM antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  36. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4134

    Description: epitope description:FDETTLNNFM antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  37. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4135

    Description: epitope description:GQAAWKEARA antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  38. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4140

    Description: epitope description:EHIFGMVLMN antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  39. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4141

    Description: epitope description:MSFIPVAEDS antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  40. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4143

    Description: epitope description:DSDFPIQNLP antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

    Publication: 15324930;

  41. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4144

    Description: epitope description:DSDFPIQNLP antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  42. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4150

    Description: epitope description:DSDFPIQNLP antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  43. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4154

    Description: epitope description:LPVGYHGRAS antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  44. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4156

    Description: epitope description:YHGRASSIVV antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  45. Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

    ID: 4164

    Description: epitope description:KELRQRAFTS antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

    Publication: 15324930;

  46. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8699

    Description: epitope description:TGSQDFFVRSIG antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  47. Identification of immunodominant epitope of F1 antigen of Yersinia pestis.

    ID: 8701

    Description: epitope description:TGSQDFFVRSIG antigen name:F1 capsule antigen host organism:Mus musculus

    Publication: 10640611;

  48. Human recombinant neutralizing antibodies against hantaan virus G2 protein.

    ID: 8862

    Description: epitope description:KVMATIDSF antigen name:Hantaan orthohantavirus protein host organism:Homo sapiens antibody name:multiple

    Publication: 12706090;

  49. Role of S-layer protein antigenic diversity in the immune responses of sheep experimentally challenged with Campylobacter fetus subsp. fetus.

    ID: 8940

    Description: epitope description:MLNKTDVSMLYITIMGMASE antigen name:UniProt:A0A089VTC6 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 12496160;

  50. N-terminus of M2 protein could induce antibodies with inhibitory activity against influenza virus replication.

    ID: 8945

    Description: epitope description:ETPIRNEWGCR antigen name:Matrix protein 2 host organism:Oryctolagus cuniculus

    Publication: 12628550;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston