Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675174

    Description: epitope description:VLRWLQLSAERGDLQ antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  2. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675175

    Description: epitope description:AERGDLQREGLYVPH antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  3. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675179

    Description: epitope description:VQVVDDNGNTVFDDE antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  4. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675180

    Description: epitope description:NTVFDDELRQGQVLT antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  5. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675182

    Description: epitope description:PQNFAVAKRAESEGF antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  6. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675183

    Description: epitope description:RAESEGFEWVAFKTN antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  7. Linear IgE-epitope mapping and comparative structural homology modeling of hazelnut and English walnut 11S globulins.

    ID: 1675189

    Description: epitope description:ARRLKYNRQETTLVR antigen name:Cor a 9 host organism:Homo sapiens

    Publication: 19631385;

  8. Comparison of properties of murine monoclonal anti-idiotypic antibodies generated with idiotype-bearing monoclonal antibodies to myelin basic protein ...

    ID: 1675192

    Description: epitope description:ASQKRPSQR + ACET(1A) antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus BALB/c antibody name:F23C6

    Publication: 7508836;

  9. Vaccination with peptides from MHC class II beta chain hypervariable region causes allele-specific suppression of EAE.

    ID: 1675273

    Description: epitope description:AEYWNSQPEILERTRAE + ACET(A1) antigen name:H-2 class II histocompatibility antigen, A-D beta chain host organism:Mus musculus SJL X...

    Publication: 8765334;

  10. Vaccination with peptides from MHC class II beta chain hypervariable region causes allele-specific suppression of EAE.

    ID: 1675276

    Description: epitope description:AEYWNSQPEILERTRAE + ACET(A1) antigen name:H-2 class II histocompatibility antigen, A-D beta chain host organism:Mus musculus SJL X...

    Publication: 8765334;

  11. Vaccination with peptides from MHC class II beta chain hypervariable region causes allele-specific suppression of EAE.

    ID: 1675286

    Description: epitope description:AEYYNKQYLEQTRAELDT + ACET(A1) antigen name:H-2 class II histocompatibility antigen, A-S beta chain host organism:Mus musculus SJL ...

    Publication: 8765334;

  12. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675346

    Description: epitope description:PGFGYGG antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus antibody name:Clone 17

    Publication: 2448611;

  13. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675349

    Description: epitope description:PGFGYGG antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus antibody name:Clone 17

    Publication: 2448611;

  14. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675352

    Description: epitope description:WGAEGQKPGFGYGG antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus antibody name:Clone 2

    Publication: 2448611;

  15. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675354

    Description: epitope description:SLSRFSWGAE antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus norvegicus DA antibody name:Clone 2.204.2

    Publication: 2448611;

  16. A survey of the prevalence of penicillin-specific IgG, IgM and IgE antibodies detected by ELISA and defined by hapten inhibition, in patients with sus...

    ID: 1675356

    Description: epitope description:benzylpenicilloyl group host organism:Homo sapiens

    Publication: 3358899;

  17. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675363

    Description: epitope description:QDENPVVHFFKNIV antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus norvegicus Wistar antibody name:Clone 12

    Publication: 2448611;

  18. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675368

    Description: epitope description:HFFKNIVTPR antigen name:Myelin basic protein (UniProt:P02686) host organism:Rattus norvegicus DA antibody name:Clone 2.225.6

    Publication: 2448611;

  19. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675379

    Description: epitope description:DHARHGFLPRHRD antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus antibody name:MAb 1924.22

    Publication: 2448611;

  20. Generation of antibodies specific to D-mannitol, a unique haptenic allergen, using reductively aminated D-mannose-bovine serum albumin conjugate as th...

    ID: 1675388

    Description: epitope description:D-mannitol host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17336832;

  21. Monoclonal antibodies reactive with myelin basic protein.

    ID: 1675398

    Description: epitope description:KAQHGRP antigen name:Myelin basic protein host organism:Mus musculus antibody name:Clone 3

    Publication: 2448611;

  22. Monoclonal antibodies to human myelin basic protein.

    ID: 1675413

    Description: epitope description:FKNIVTPRTPPPSQGKGRGLSLSRFSW antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus PL/J X SJL antibody name...

    Publication: 2415682;

  23. Monoclonal antibodies to human myelin basic protein.

    ID: 1675416

    Description: epitope description:AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG antigen name:Myelin basic protein (UniProt:P02686) host organism:Mus musculus SJL antibod...

    Publication: 2415682;

  24. Methyl tertiary-butyl ether antibodies among gasoline service station attendants.

    ID: 1675424

    Description: epitope description:methyl tert-butyl ether host organism:Homo sapiens

    Publication: 9472332;

  25. HLA class II transgenic mice authenticate restriction of myelin oligodendrocyte glycoprotein-specific immune response implicated in multiple sclerosis...

    ID: 1675510

    Description: epitope description:YRNGKDQDGDQAPEYRGRTE antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Mus musculus HLA-DQ8 Tg

    Publication: 12663683;

  26. HLA class II transgenic mice authenticate restriction of myelin oligodendrocyte glycoprotein-specific immune response implicated in multiple sclerosis...

    ID: 1675513

    Description: epitope description:QAPEYRGRTELLKDAIGEGK antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Mus musculus HLA-DQ8 Tg

    Publication: 12663683;

  27. HLA class II transgenic mice authenticate restriction of myelin oligodendrocyte glycoprotein-specific immune response implicated in multiple sclerosis...

    ID: 1675534

    Description: epitope description:AVLPVLLLQITVGLVFLCLQ antigen name:Myelin-oligodendrocyte glycoprotein (UniProt:Q16653) host organism:Mus musculus HLA-DQ8 Tg

    Publication: 12663683;

  28. Induction of a multiple sclerosis-like disease in mice with an immunodominant epitope of myelin oligodendrocyte glycoprotein.

    ID: 1675735

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Rattus

    Publication: 9771980;

  29. Characterization of phosphorylcholine- (PC) specific IgE-B cells in CBA/N or (CBA/N x BALB/c)F1 male mice.

    ID: 1675747

    Description: epitope description:phosphocholine host organism:Mus musculus CBA

    Publication: 6790611;

  30. IgE antibodies for penicillins and cephalosporins in rats. III. Antigenic specificity of rat anti-cephalosporin-OvA IgE sera.

    ID: 1675762

    Description: epitope description:cefsulodin host organism:Rattus norvegicus Sprague-Dawley

    Publication: 6166604;

  31. Comparison of the immunogenicity of wasp venom peptides with or without carbohydrate moieties.

    ID: 1675763

    Description: epitope description:TATTRRRGRPPGFSPFR antigen name:Vespula maculifrons (eastern yellowjacket) protein host organism:Mus musculus BALB/c

    Publication: 9604295;

  32. IgE antibodies for penicillins and cephalosporins in rats. III. Antigenic specificity of rat anti-cephalosporin-OvA IgE sera.

    ID: 1675768

    Description: epitope description:cefsulodin host organism:Rattus norvegicus Sprague-Dawley

    Publication: 6166604;

  33. IgE antibodies for penicillins and cephalosporins in rats. III. Antigenic specificity of rat anti-cephalosporin-OvA IgE sera.

    ID: 1675773

    Description: epitope description:sulbenicillin host organism:Rattus norvegicus Sprague-Dawley

    Publication: 6166604;

  34. IgE antibodies for penicillins and cephalosporins in rats. III. Antigenic specificity of rat anti-cephalosporin-OvA IgE sera.

    ID: 1675788

    Description: epitope description:cefaloridine host organism:Rattus norvegicus Sprague-Dawley

    Publication: 6166604;

  35. Heterogeneity of IgE epitopes of vinyl sulphone reactive dye: human serum albumin that react with IgE.

    ID: 1675814

    Description: epitope description:remazole black-GR host organism:Homo sapiens

    Publication: 11696055;

  36. Autoimmune spread to myelin is associated with experimental autoimmune encephalomyelitis induced by a neuronal protein, beta-synuclein.

    ID: 1675827

    Description: epitope description:KKEEFPTDLKPEEVAQEAAEEPLIE antigen name:Beta-synuclein host organism:Rattus norvegicus Lewis

    Publication: 19189872;

  37. Autoimmune spread to myelin is associated with experimental autoimmune encephalomyelitis induced by a neuronal protein, beta-synuclein.

    ID: 1675833

    Description: epitope description:LKPEEVAQEAAEEPLIEPL antigen name:Beta-synuclein host organism:Rattus norvegicus Lewis

    Publication: 19189872;

  38. Autoimmune spread to myelin is associated with experimental autoimmune encephalomyelitis induced by a neuronal protein, beta-synuclein.

    ID: 1675837

    Description: epitope description:GVLYVGSKTSGVVQGVASVAEKTKE antigen name:Beta-synuclein host organism:Rattus norvegicus Lewis

    Publication: 19189872;

  39. Autoimmune spread to myelin is associated with experimental autoimmune encephalomyelitis induced by a neuronal protein, beta-synuclein.

    ID: 1675838

    Description: epitope description:VQGVASVAEKTKEQASHLGGAVFSG antigen name:Beta-synuclein host organism:Rattus norvegicus Lewis

    Publication: 19189872;

  40. Autoimmune spread to myelin is associated with experimental autoimmune encephalomyelitis induced by a neuronal protein, beta-synuclein.

    ID: 1675842

    Description: epitope description:EVAQEAAEEPLIEPLMEPEGESYED antigen name:Beta-synuclein host organism:Rattus norvegicus Lewis

    Publication: 19189872;

  41. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675861

    Description: epitope description:IPKVPPGPNITA antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  42. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675869

    Description: epitope description:WYGKPTAAGP antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  43. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675875

    Description: epitope description:YKDVDKPPFS antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  44. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675876

    Description: epitope description:VDKPPFSGMT antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  45. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675878

    Description: epitope description:IPKVPPGPNITA + HYL(P5, P8) antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  46. Post-translational modifications influence IgE reactivity to the major allergen Phl p 1 of timothy grass pollen.

    ID: 1675879

    Description: epitope description:VPPGPNITAT + HYL(P2, P5) antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 9543081;

  47. Differential effects of IL-21 during initiation and progression of autoimmunity against neuroantigen.

    ID: 1675909

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Mus musculus C57BL/6

    Publication: 15728477;

  48. Differential effects of IL-21 during initiation and progression of autoimmunity against neuroantigen.

    ID: 1675910

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Mus musculus C57BL/6

    Publication: 15728477;

  49. Differential effects of IL-21 during initiation and progression of autoimmunity against neuroantigen.

    ID: 1675911

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Mus musculus C57BL/6

    Publication: 15728477;

  50. Relevance of IgE binding to short peptides for the allergenic activity of food allergens.

    ID: 1683806

    Description: epitope description:LRAPQRCDLEVESGG antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 19596143;

  51. Use of hexyl isocyanate antigen to detect antibodies to hexamethylene diisocyanate (HDI) in sensitized guinea pigs and in a sensitized worker.

    ID: 1683820

    Description: epitope description:hexamethylene diisocyanate host organism:Cavia porcellus

    Publication: 6821040;

  52. Use of hexyl isocyanate antigen to detect antibodies to hexamethylene diisocyanate (HDI) in sensitized guinea pigs and in a sensitized worker.

    ID: 1683824

    Description: epitope description:hexamethylene diisocyanate host organism:Cavia porcellus

    Publication: 6821040;

  53. Use of hexyl isocyanate antigen to detect antibodies to hexamethylene diisocyanate (HDI) in sensitized guinea pigs and in a sensitized worker.

    ID: 1683827

    Description: epitope description:hexamethylene diisocyanate host organism:Cavia porcellus

    Publication: 6821040;

  54. Use of hexyl isocyanate antigen to detect antibodies to hexamethylene diisocyanate (HDI) in sensitized guinea pigs and in a sensitized worker.

    ID: 1683834

    Description: epitope description:cyclohexyl isocyanate host organism:Cavia porcellus

    Publication: 6821040;

  55. Use of hexyl isocyanate antigen to detect antibodies to hexamethylene diisocyanate (HDI) in sensitized guinea pigs and in a sensitized worker.

    ID: 1683843

    Description: epitope description:hexyl isocyanate host organism:Cavia porcellus

    Publication: 6821040;

  56. Use of hexyl isocyanate antigen to detect antibodies to hexamethylene diisocyanate (HDI) in sensitized guinea pigs and in a sensitized worker.

    ID: 1683850

    Description: epitope description:cyclohexyl isocyanate host organism:Cavia porcellus

    Publication: 6821040;

  57. Use of hexyl isocyanate antigen to detect antibodies to hexamethylene diisocyanate (HDI) in sensitized guinea pigs and in a sensitized worker.

    ID: 1683852

    Description: epitope description:4-tolyl isocyanate host organism:Cavia porcellus

    Publication: 6821040;

  58. Use of hexyl isocyanate antigen to detect antibodies to hexamethylene diisocyanate (HDI) in sensitized guinea pigs and in a sensitized worker.

    ID: 1683859

    Description: epitope description:hexamethylene diisocyanate host organism:Cavia porcellus

    Publication: 6821040;

  59. Antibodies against a class II HLA-peptide complex raised by active immunization of mice with antigen mimicking peptides.

    ID: 1683875

    Description: epitope description:CAYSVAHLC host organism:Mus musculus NMRI

    Publication: 19630914;

  60. Antibodies against a class II HLA-peptide complex raised by active immunization of mice with antigen mimicking peptides.

    ID: 1683886

    Description: epitope description:CAYSVAHLC host organism:Mus musculus NMRI

    Publication: 19630914;

  61. Separation and characterization of anti-benzylpenicilloyl (BPO) antibodies. II. Immunological properties of different IgG fractions.

    ID: 1684017

    Description: epitope description:benzylpenicilloyl group host organism:Oryctolagus cuniculus antibody name:Rabbit sera

    Publication: 97350;

  62. Identification of an antigenic determinant within the phylogenetically conserved triprolyl region of myelin basic protein.

    ID: 1684111

    Description: epitope description:RTPPPSG host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2416809;

  63. Myelin proteolipid protein (PLP) as a marker antigen of central nervous system contaminations for routine food control.

    ID: 1684171

    Description: epitope description:CGKGLSATVTGGQKGRGSR antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 17629299;

  64. Myelin proteolipid protein (PLP) as a marker antigen of central nervous system contaminations for routine food control.

    ID: 1684174

    Description: epitope description:CGKGLSATVTGGQKGRGSR antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 17629299;

  65. Fresh vs aged benzylpenicillin on non-IgE responses in mice.

    ID: 1684184

    Description: epitope description:benzylpenicillin host organism:Mus musculus BALB/c

    Publication: 10375765;

  66. Fresh vs aged benzylpenicillin on non-IgE responses in mice.

    ID: 1684201

    Description: epitope description:benzylpenicillin host organism:Mus musculus BALB/c

    Publication: 10375765;

  67. Anaphylaxis to excipient mannitol: evidence for an immunoglobulin E-mediated mechanism.

    ID: 1684202

    Description: epitope description:D-mannitol host organism:Homo sapiens

    Publication: 15479277;

  68. Anaphylaxis to excipient mannitol: evidence for an immunoglobulin E-mediated mechanism.

    ID: 1684205

    Description: epitope description:D-mannitol host organism:Homo sapiens

    Publication: 15479277;

  69. Myelin proteolipid protein (PLP) as a marker antigen of central nervous system contaminations for routine food control.

    ID: 1684209

    Description: epitope description:CGKGLSATVTGGQKGRGSR antigen name:Myelin proteolipid protein host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 17629299;

  70. Anti-phosphorylcholine antibodies with a preferred reactivity for either PC or PC-phenyl represent independent expressions.

    ID: 1684230

    Description: epitope description:phosphocholine host organism:Mus musculus BALB/c antibody name:28-1

    Publication: 6424547;

  71. Anti-phosphorylcholine antibodies with a preferred reactivity for either PC or PC-phenyl represent independent expressions.

    ID: 1684233

    Description: epitope description:p-nitrophenylphosphocholine host organism:Mus musculus BALB/c antibody name:28-1

    Publication: 6424547;

  72. A serum factor cross-reactive with antibodies to a determinant of rabbit encephalitogenic sequence 65-74 of myelin basic protein.

    ID: 1684244

    Description: epitope description:TTHYGSLPQK antigen name:Myelin basic protein host organism:Oryctolagus cuniculus

    Publication: 2582288;

  73. Phenyl isocyanate is a potent chemical sensitizer.

    ID: 1684255

    Description: epitope description:hexamethylene diisocyanate host organism:Mus musculus BALB/c

    Publication: 8960156;

  74. Phenyl isocyanate is a potent chemical sensitizer.

    ID: 1684259

    Description: epitope description:diphenylmethane-4,4'-diisocyanate host organism:Mus musculus BALB/c

    Publication: 8960156;

  75. Analysis of the antibody responses induced by subcutaneous injection immunotherapy with birch and Fagales pollen extracts adsorbed onto aluminum hydro...

    ID: 1684274

    Description: epitope description:MGVFNYETETTSVIPAARLFKAFI antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 19672093;

  76. Analysis of the antibody responses induced by subcutaneous injection immunotherapy with birch and Fagales pollen extracts adsorbed onto aluminum hydro...

    ID: 1684282

    Description: epitope description:LFPKVAPQAISSVENIEGNGGPGTIKKISF antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 19672093;

  77. Analysis of the antibody responses induced by subcutaneous injection immunotherapy with birch and Fagales pollen extracts adsorbed onto aluminum hydro...

    ID: 1684298

    Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 19672093;

  78. Analysis of the antibody responses induced by subcutaneous injection immunotherapy with birch and Fagales pollen extracts adsorbed onto aluminum hydro...

    ID: 1684303

    Description: epitope description:KAEQVKASKEMGETLLRAVESYLLAHSDAYN antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 19672093;

  79. Induction of ethylenediamine hypersensitivity in the guinea pig and the development of ELISA and lymphocyte blastogenesis techniques for its character...

    ID: 1684362

    Description: epitope description:ethylenediamine host organism:Cavia porcellus Hartley

    Publication: 3692019;

  80. Benzylpenicillin induced specific non-IgE antibody response in mice.

    ID: 1684393

    Description: epitope description:ampicillin host organism:Mus musculus BALB/c

    Publication: 9863149;

  81. Benzylpenicillin induced specific non-IgE antibody response in mice.

    ID: 1684395

    Description: epitope description:piperacillin host organism:Mus musculus BALB/c

    Publication: 9863149;

  82. Diisocyanate antigens that detect specific antibodies in exposed workers and guinea pigs.

    ID: 1684425

    Description: epitope description:diphenylmethane-4,4'-diisocyanate host organism:Cavia porcellus

    Publication: 2979745;

  83. Diisocyanate antigens that detect specific antibodies in exposed workers and guinea pigs.

    ID: 1684426

    Description: epitope description:diphenylmethane-4,4'-diisocyanate host organism:Cavia porcellus

    Publication: 2979745;

  84. Diisocyanate antigens that detect specific antibodies in exposed workers and guinea pigs.

    ID: 1684431

    Description: epitope description:diphenylmethane-4,4'-diisocyanate host organism:Homo sapiens

    Publication: 2979745;

  85. Characterization of murine immune responses to allergenic diisocyanates.

    ID: 1684595

    Description: epitope description:diphenylmethane-4,4'-diisocyanate host organism:Mus musculus BALB/c

    Publication: 1539157;

  86. Characterization of murine immune responses to allergenic diisocyanates.

    ID: 1684596

    Description: epitope description:dicyclohexylmethane-4,4'-diisocyanate host organism:Mus musculus BALB/c

    Publication: 1539157;

  87. Characterization of murine immune responses to allergenic diisocyanates.

    ID: 1684600

    Description: epitope description:isophorone diisocyanate host organism:Mus musculus BALB/c

    Publication: 1539157;

  88. Epitopes of immunoreactive myelin basic protein in human cerebrospinal fluid.

    ID: 1684671

    Description: epitope description:FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDQDPVVHF antigen name:Myelin basic protein (UniProt:P02686) host organism:Oryctolagus cunicul...

    Publication: 2429613;

  89. Antigenized antibodies expressing Vbeta8.2 TCR peptides immunize against rat experimental allergic encephalomyelitis.

    ID: 1684717

    Description: epitope description:DMGHGLRLIHYSYDVNSTEKG antigen name:T-cell receptor host organism:Rattus norvegicus Lewis

    Publication: 15541175;

  90. Mimicry of a 21.5 kDa myelin basic protein peptide by a Maedi Visna virus polymerase peptide does not contribute to the pathogenesis of encephalitis i...

    ID: 1684721

    Description: epitope description:TGKIPWILLPGR antigen name:pol polyprotein host organism:Ovis aries

    Publication: 9014312;

  91. Mimicry of a 21.5 kDa myelin basic protein peptide by a Maedi Visna virus polymerase peptide does not contribute to the pathogenesis of encephalitis i...

    ID: 1684726

    Description: epitope description:SGKVPWLKPGR antigen name:Myelin basic protein (UniProt:P02686) host organism:Ovis aries

    Publication: 9014312;

  92. Recognition and degradation of myelin basic protein peptides by serum autoantibodies: novel biomarker for multiple sclerosis.

    ID: 1684779

    Description: epitope description:TASTMDHARHGFLPRHRDTGILDSIGRFFGG antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 18178866;

  93. Recognition and degradation of myelin basic protein peptides by serum autoantibodies: novel biomarker for multiple sclerosis.

    ID: 1684782

    Description: epitope description:KRGSGKDSHHPARTAHYGSLPQKSHGRTQ antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 18178866;

  94. Recognition and degradation of myelin basic protein peptides by serum autoantibodies: novel biomarker for multiple sclerosis.

    ID: 1684798

    Description: epitope description:RHGFLPRHRDTGILDSIGRFFGGDRGAPKR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 18178866;

  95. Recognition and degradation of myelin basic protein peptides by serum autoantibodies: novel biomarker for multiple sclerosis.

    ID: 1684799

    Description: epitope description:RFFGGDRGAPKRGSGKDSHHPARTAH antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 18178866;

  96. Recognition and degradation of myelin basic protein peptides by serum autoantibodies: novel biomarker for multiple sclerosis.

    ID: 1684801

    Description: epitope description:RTAHYGSLPQKSHGRTQDENPVVHFFKN antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 18178866;

  97. Recognition and degradation of myelin basic protein peptides by serum autoantibodies: novel biomarker for multiple sclerosis.

    ID: 1684804

    Description: epitope description:RGLSLSRFSWGAEGQRPGFGYGGRAS antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

    Publication: 18178866;

  98. Immunologic tests of specific antibodies to organic acid anhydrides.

    ID: 1684864

    Description: epitope description:methyltetrahydrophthalic anhydride host organism:Homo sapiens

    Publication: 1789402;

  99. Immunologic tests of specific antibodies to organic acid anhydrides.

    ID: 1684866

    Description: epitope description:methyltetrahydrophthalic anhydride host organism:Homo sapiens

    Publication: 1789402;

  100. Immunologic tests of specific antibodies to organic acid anhydrides.

    ID: 1684868

    Description: epitope description:methyltetrahydrophthalic anhydride host organism:Homo sapiens

    Publication: 1789402;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston