Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1254

Description: epitope description:IADYNYKLPDDFMGCVL antigen name:Spike glycoprotein host organism:Homo sapiens

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1261

Description: epitope description:CVLAWNTRNIDATSTGN antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1263

Description: epitope description:NIDATSTGNYNYKYRYL antigen name:Spike glycoprotein host organism:Homo sapiens

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1269

Description: epitope description:LRHGKLRPFERDISNVP antigen name:Spike glycoprotein host organism:Homo sapiens

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1278

Description: epitope description:SPDGKPCTPPALNCYWP antigen name:Spike glycoprotein host organism:Homo sapiens

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1299

Description: epitope description:CGPKLSTDLIKNQCVNF antigen name:Spike glycoprotein host organism:Homo sapiens

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1312

Description: epitope description:RFQPFQQFGRDVSDFTD antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4167

Description: epitope description:NVGIMFRGKE antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4170

Description: epitope description:MFRGKENALL antigen name:Fumarylacetoacetase host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4175

Description: epitope description:TTQTKPKSAF antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4179

Description: epitope description:GDHCEGLGVL antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4182

Description: epitope description:ANAEALNNLL antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4187

Description: epitope description:STETVEVSQG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4222

Description: epitope description:MSFVPGQENA antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4226

Description: epitope description:GQQKQLLPRW antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4231

Description: epitope description:VYVRPIIEDY antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4233

Description: epitope description:LQFGYTSRSM antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4238

Description: epitope description:GNYRLPSNKP antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:anti-FAH Ab

Sequence similarity and structural homologies are involved in the autoimmune response elicited by mouse hepatitis virus A59.

ID: 4247

Description: epitope description:RELQKRLYSN antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:anti-MHV Ab

Identification of the epitope of a monoclonal antibody to DJ-1.

ID: 4454

Description: epitope description:ASLEDAKKEGPYDVVVLPGGNLG antigen name:Protein deglycase DJ-1 host organism:Mus musculus antibody name:3E8

Pathogenic human thyroglobulin peptides in HLA-DR3 transgenic mouse model of autoimmune thyroiditis.

ID: 4543

Description: epitope description:ENLLKEAIRAIFPSR antigen name:Thyroglobulin host organism:Mus musculus NOD HLA-DR3 Tg IAbeta null

Pathogenic human thyroglobulin peptides in HLA-DR3 transgenic mouse model of autoimmune thyroiditis.

ID: 4549

Description: epitope description:LSSVVVDPSIRHFDV antigen name:Thyroglobulin host organism:Mus musculus NOD HLA-DR3 Tg IAbeta null

Novel biomarker of HTLV-1-associated disease: specific appearance of antibody recognizing the receptor-binding site on HTLV-1 envelope protein.

ID: 4603

Description: epitope description:DHILEPSIPWKSKLLTLVQL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Use of a synthetic peptide epitope of Asp f 1, a major allergen or antigen of Aspergillus fumigatus, for improved immunodiagnosis of allergic bronchop...

ID: 4708

Description: epitope description:LNPKTNKWEDK antigen name:Asp f 1 host organism:Homo sapiens

Use of a synthetic peptide epitope of Asp f 1, a major allergen or antigen of Aspergillus fumigatus, for improved immunodiagnosis of allergic bronchop...

ID: 4711

Description: epitope description:INQQLNPK antigen name:Asp f 1 host organism:Homo sapiens

Use of a synthetic peptide epitope of Asp f 1, a major allergen or antigen of Aspergillus fumigatus, for improved immunodiagnosis of allergic bronchop...

ID: 4716

Description: epitope description:LNPKTNKWEDKRY antigen name:Asp f 1 host organism:Homo sapiens

Recognition of a cell-surface oligosaccharide of pathogenic Salmonella by an antibody Fab fragment.

ID: 4737

Description: epitope description:alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp antigen name:lipopolysaccharide host organism:Mus musculus BALB/c antibody ...

Discovery of human antibodies against the C5aR target using phage display technology.

ID: 1036

Description: epitope description:MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN antigen name:C5a anaphylatoxin chemotactic receptor 1 host organism:Homo sapiens antibody name:IgG...

Identification of a transiently exposed VE-cadherin epitope that allows for specific targeting of an antibody to the tumor neovasculature.

ID: 1048

Description: epitope description:DWIWNQMHIDEEKNE antigen name:Cadherin-5 host organism:Rattus norvegicus Lewis antibody name:E4G10

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1077

Description: epitope description:CTDVSTAIHADQLTPAWRIYSTGNNVFQTQAG antigen name:Spike glycoprotein host organism:Homo sapiens

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1097

Description: epitope description:FRSDTLYLTQDLFLPFY antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1106

Description: epitope description:HTINHTFGNPVIPFKDG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1112

Description: epitope description:DGIYFAATEKSNVVRGW antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1124

Description: epitope description:IINNSTNVVIRACNFEL antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1125

Description: epitope description:IINNSTNVVIRACNFEL antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1131

Description: epitope description:NFELCDNPFFAVSKPMG antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1133

Description: epitope description:FFAVSKPMGTQTHTMIF antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1139

Description: epitope description:THTMIFDNAFNCTFEYI antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1142

Description: epitope description:NAFNCTFEYISDAFSLD antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1160

Description: epitope description:YQPIDVVRDLPSGFNTL antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1161

Description: epitope description:YQPIDVVRDLPSGFNTL antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1167

Description: epitope description:LKPIFKLPLGINITNFR antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS d...

ID: 1180

Description: epitope description:WGTSAAAYFVGYLKPTT antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus New Zealand White

Structural basis for the binding of an anti-cytochrome c antibody to its antigen: crystal structures of FabE8-cytochrome c complex to 1.8 A resolution...

ID: 14

Description: epitope description:F37, G38, K61, E62, E63, A97, K100, K101, N104, E105 antigen name:Cytochrome c host organism:Mus musculus BALB/c antibody name:E8

The crystal structure of human angiogenin in complex with an antitumor neutralizing antibody.

ID: 32

Description: epitope description:G58, L59, S61, P62, C63, K64, D65, G109, G110, S111, P112, W113, P114, P115 antigen name:Angiogenin host organism:Mus musculus BAL...

Epitope mapping and features of the epitope for monoclonal antibodies inhibiting enzymatic activity of Helicobacter pylori urease.

ID: 220

Description: epitope description:IFGFNALVDR antigen name:Urease subunit alpha host organism:Oryctolagus cuniculus

Identification and characterization of linear B-cell epitopes of beta-globulin, a major allergen of sesame seeds.

ID: 341

Description: epitope description:EESFLRSAEA antigen name:Ses i 2 host organism:Homo sapiens

Identification and characterization of linear B-cell epitopes of beta-globulin, a major allergen of sesame seeds.

ID: 343

Description: epitope description:SFLRSAEANQ antigen name:Ses i 2 host organism:Homo sapiens

Identification and characterization of linear B-cell epitopes of beta-globulin, a major allergen of sesame seeds.

ID: 344

Description: epitope description:LRSAEANQG antigen name:Ses i 2 host organism:Homo sapiens

A new antigenic epitope appears in the catalytic subunit of viscumin during intracellular transport.

ID: 10248

Description: epitope description:RYRQYINS antigen name:Beta-galactoside-specific lectin 1 host organism:Mus musculus BALB/c antibody name:Anti-MLA Ab