Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415589

    Description: epitope description:CFKKPPKYPPALPI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  2. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415590

    Description: epitope description:CFKKPPKYPPALPI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  3. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415591

    Description: epitope description:PLLDRWKAPDYVPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  4. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415594

    Description: epitope description:PLLDRWKAPDYVPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  5. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415599

    Description: epitope description:PAADRAAAPDAVAA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  6. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415607

    Description: epitope description:TVHGCALPPRGAPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  7. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415610

    Description: epitope description:TVHGCALPPRGAPP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  8. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415611

    Description: epitope description:VPPPRRKRTIQLDG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  9. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415615

    Description: epitope description:VPPPRRKRTIQLDG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  10. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415620

    Description: epitope description:DGSNVLAALAALAE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  11. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415621

    Description: epitope description:ALAALAEKSFPSSS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  12. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415626

    Description: epitope description:KSFPSSSSSGVDTS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  13. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415630

    Description: epitope description:KSFPSSSSSGVDTS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  14. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415638

    Description: epitope description:SSTTSKVPPSPGGE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  15. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415651

    Description: epitope description:STVSDSEEQSVVCC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  16. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415663

    Description: epitope description:QVLDDHYKTALKEV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  17. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415664

    Description: epitope description:QVLDDHYKTALKEV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  18. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415672

    Description: epitope description:RSKFGYSAKDVRSL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  19. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415683

    Description: epitope description:QQRVERLLKMWTSK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  20. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415685

    Description: epitope description:QQRVERLLKMWTSK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  21. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415686

    Description: epitope description:VEEEIYQCCNLEPE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  22. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415694

    Description: epitope description:CCNLEPEARKVISS antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  23. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415698

    Description: epitope description:LYCGGPMFNSKGAQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  24. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415702

    Description: epitope description:SGVLPTSFGNTITC antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  25. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415709

    Description: epitope description:TAAAKAAGLRNPDF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  26. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415713

    Description: epitope description:VAESDGVDEDRAAL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  27. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415714

    Description: epitope description:VAESDGVDEDRAAL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  28. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415716

    Description: epitope description:VARDDKGRRYYYLT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  29. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415717

    Description: epitope description:VARDDKGRRYYYLT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  30. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415719

    Description: epitope description:VARDDKGRRYYYLT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  31. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415726

    Description: epitope description:FSILQSQEILDRPL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  32. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415727

    Description: epitope description:FSILQSQEILDRPL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  33. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415728

    Description: epitope description:FSILQSQEILDRPL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  34. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415731

    Description: epitope description:PLDFEMYGATYSVT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  35. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415737

    Description: epitope description:CPPLRAWRHRARAV antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  36. Immunogenicity of variable regions of hepatitis C virus proteins: selection and modification of peptide epitopes to assess hepatitis C virus genotypes...

    ID: 1415746

    Description: epitope description:PLPAAGQLDLSSWF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10092013;

  37. Expression of HTLV-I Env and Tax recombinant peptides in yeast: identification of immunogenic domains.

    ID: 1463995

    Description: epitope description:TPLLYPSLALPAPHLTLPFNWTH antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 7679862;

  38. Candidate peptide-vaccine induced potent protection against CSFV and identified a principal sequential neutralizing determinant on E2.

    ID: 1464042

    Description: epitope description:CKEDYRYAISSTNEIGLLGAGGLT antigen name:Genome polyprotein host organism:Sus scrofa antibody name:Porcine serum

    Publication: 16154668;

  39. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1464046

    Description: epitope description:TTDSGDGRQTIT antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8890224;

  40. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1464066

    Description: epitope description:QTITNPAYDEKR antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8890224;

  41. Fine mapping of outer membrane protein P2 antigenic sites which vary during persistent infection by Haemophilus influenzae.

    ID: 1464070

    Description: epitope description:TDSSSDSQTITN antigen name:Other Haemophilus influenzae protein host organism:Oryctolagus cuniculus

    Publication: 8890224;

  42. Candidate peptide-vaccine induced potent protection against CSFV and identified a principal sequential neutralizing determinant on E2.

    ID: 1464084

    Description: epitope description:SHDLQLNDGTVKAICVAGSFKVT antigen name:Genome polyprotein host organism:Sus scrofa antibody name:Porcine serum

    Publication: 16154668;

  43. Candidate peptide-vaccine induced potent protection against CSFV and identified a principal sequential neutralizing determinant on E2.

    ID: 1464086

    Description: epitope description:SHDLQLNDGTVKAICVAGSFKVT antigen name:Genome polyprotein host organism:Sus scrofa antibody name:Porcine serum

    Publication: 16154668;

  44. Candidate peptide-vaccine induced potent protection against CSFV and identified a principal sequential neutralizing determinant on E2.

    ID: 1464096

    Description: epitope description:SLHKGALLTSVTFELLFDGTN antigen name:Genome polyprotein host organism:Sus scrofa antibody name:Porcine serum

    Publication: 16154668;

  45. Mutational analysis of amino acid positions crucial for IgE-binding epitopes of the major apple (Malus domestica) allergen, Mal d 1.

    ID: 1464105

    Description: epitope description:T11, F31, S57, S113, I114 antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 16293967;

  46. The hevein domain of the major latex-glove allergen Hev b 6.01 contains dominant T cell reactive sites.

    ID: 1464109

    Description: epitope description:SQWGWCGSTDEYCSPDHNCQ antigen name:Hev b 6 host organism:Mus musculus antibody name:1A5.4.3

    Publication: 15080815;

  47. A subgroup-specific antigenic site in the G protein of respiratory syncytial virus forms a disulfide-bonded loop.

    ID: 1464113

    Description: epitope description:SICGNNQLCKSICKT antigen name:Major surface glycoprotein G host organism:Mus musculus antibody name:8188, 8305, 9177, 26

    Publication: 1697913;

  48. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464115

    Description: epitope description:KKPNRQGLGYYSPSYNDP antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  49. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464118

    Description: epitope description:TSEPTQPPPTSPPLVHDSDLEHVLTPSTSWTTKILKF antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  50. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464125

    Description: epitope description:APPSQPFPWTHCYQPRL antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston