Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "

  1. The hevein domain of the major latex-glove allergen Hev b 6.01 contains dominant T cell reactive sites.

    ID: 1464109

    Description: epitope description:SQWGWCGSTDEYCSPDHNCQ antigen name:Hev b 6 host organism:Mus musculus antibody name:1A5.4.3

    Publication: 15080815;

  2. A subgroup-specific antigenic site in the G protein of respiratory syncytial virus forms a disulfide-bonded loop.

    ID: 1464113

    Description: epitope description:SICGNNQLCKSICKT antigen name:Major surface glycoprotein G host organism:Mus musculus antibody name:8188, 8305, 9177, 26

    Publication: 1697913;

  3. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464115

    Description: epitope description:KKPNRQGLGYYSPSYNDP antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  4. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464118

    Description: epitope description:TSEPTQPPPTSPPLVHDSDLEHVLTPSTSWTTKILKF antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;

  5. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464125

    Description: epitope description:APPSQPFPWTHCYQPRL antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;
Displaying 5 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston