B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692336

Description: epitope description:KKPKKEEEQKWKWWEEERYP antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692341

Description: epitope description:AEEVATFFAKMLDHEYTTKE antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692345

Description: epitope description:DFTQMSQYFKAQTEARKQMS antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692346

Description: epitope description:TEARKQMSKEEKLKIKEENE antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692353

Description: epitope description:PGHKWKEVRHDNKVTWLVSW antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692354

Description: epitope description:KVTWLVSWTENIQGSIKYIM antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692355

Description: epitope description:QGSIKYIMLNPSSRIKGEKD antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692362

Description: epitope description:CSLRVEHINLHPELDGQEYV antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692364

Description: epitope description:FLGKDSIRYYNKVPVEKRVF antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692369

Description: epitope description:FRTYNASITLQQQLKELTAP antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692370

Description: epitope description:QLKELTAPDENIPAKILSYN antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692379

Description: epitope description:EENKQIALGTSKLNYLDPRI antigen name:DNA topoisomerase 1 host organism:Homo sapiens

Sera from JRA patients contain antibodies against a defined epitope in chromosomal protein HMG-17.

ID: 1692386

Description: epitope description:VKDEPQRRSARLSAK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

Sera from JRA patients contain antibodies against a defined epitope in chromosomal protein HMG-17.

ID: 1692387

Description: epitope description:QRRSARLSAKPAPPK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

Sera from JRA patients contain antibodies against a defined epitope in chromosomal protein HMG-17.

ID: 1692390

Description: epitope description:PEPKPKKAPAKKGEK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

Sera from JRA patients contain antibodies against a defined epitope in chromosomal protein HMG-17.

ID: 1692395

Description: epitope description:AGKEGNNPAENGDAK antigen name:Non-histone chromosomal protein HMG-17 host organism:Homo sapiens

Human autoantibodies reactive with synthetic autoantigens from T-cell receptor beta chain.

ID: 1692412

Description: epitope description:CKPISGHNSLFWYRQT antigen name:T-cell receptor host organism:Homo sapiens

Human autoantibodies reactive with synthetic autoantigens from T-cell receptor beta chain.

ID: 1692413

Description: epitope description:KIQPSEPRDSAVYFCA antigen name:T-cell receptor host organism:Homo sapiens

Human autoantibodies reactive with synthetic autoantigens from T-cell receptor beta chain.

ID: 1692416

Description: epitope description:KIQPSEPRDSAVYFCA antigen name:T-cell receptor host organism:Homo sapiens

Human autoantibodies reactive with synthetic autoantigens from T-cell receptor beta chain.

ID: 1692417

Description: epitope description:QPLKEQPALNDSRYCL antigen name:T-cell receptor host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692418

Description: epitope description:MSGDHLHNDSQIEADFRLND antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692423

Description: epitope description:HKEKEKTKHKDGSSEKHKDK antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692424

Description: epitope description:SSEKHKDKHKDRDKEKRKEE antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692438

Description: epitope description:YYDGKVMKLSPKAEEVATFF antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692439

Description: epitope description:AEEVATFFAKMLDHEYTTKE antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692443

Description: epitope description:DFTQMSQYFKAQTEARKQMS antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692448

Description: epitope description:FRGRGNHPKMGMLKRRIMPE antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692449

Description: epitope description:LKRRIMPEDIIINCSKDAKV antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692460

Description: epitope description:CSLRVEHINLHPELDGQEYV antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692465

Description: epitope description:FDRLNTGILNKHLQDLMEGL antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692469

Description: epitope description:PAKILSYNRANRAVAILCNH antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692473

Description: epitope description:ARRDLKSAKADAKVMKDAKT antigen name:DNA topoisomerase 1 host organism:Homo sapiens

B-Cell epitope mapping of DNA topoisomerase I defines epitopes strongly associated with pulmonary fibrosis in systemic sclerosis.

ID: 1692480

Description: epitope description:NKTQREKFAWAIDMADEDYE antigen name:DNA topoisomerase 1 host organism:Homo sapiens

Analysis of the epitopes of proliferating cell nuclear antigen recognized by monoclonal antibodies.

ID: 1692489

Description: epitope description:VSDYEMKLMDLDVEQ antigen name:Proliferating cell nuclear antigen host organism:Mus musculus antibody name:19F4

Analysis of the epitopes of proliferating cell nuclear antigen recognized by monoclonal antibodies.

ID: 1692493

Description: epitope description:VSDYEMKLMDLDVEQ antigen name:Proliferating cell nuclear antigen host organism:Mus musculus antibody name:19F4

Analysis of the epitopes of proliferating cell nuclear antigen recognized by monoclonal antibodies.

ID: 1692494

Description: epitope description:VSDYEMKLMDLDVEQ antigen name:Proliferating cell nuclear antigen host organism:Mus musculus antibody name:19A2

Analysis of the epitopes of proliferating cell nuclear antigen recognized by monoclonal antibodies.

ID: 1692499

Description: epitope description:VSDYEMKLMDLDVEQ antigen name:Proliferating cell nuclear antigen host organism:Mus musculus antibody name:TO17, TO30

Analysis of the epitopes of proliferating cell nuclear antigen recognized by monoclonal antibodies.

ID: 1692501

Description: epitope description:VSDYEMKLMDLDVEQ antigen name:Proliferating cell nuclear antigen host organism:Mus musculus antibody name:PC10

Analysis of the epitopes of proliferating cell nuclear antigen recognized by monoclonal antibodies.

ID: 1692510

Description: epitope description:KLSQTSNVDKEEEAV antigen name:Proliferating cell nuclear antigen host organism:Mus musculus antibody name:TOB7

Recognition of IgG-derived peptides by a human IgM with an unusual combining site.

ID: 1692520

Description: epitope description:SWNSGALT antigen name:Immunoglobulin host organism:Homo sapiens antibody name:Mez

Recognition of IgG-derived peptides by a human IgM with an unusual combining site.

ID: 1692529

Description: epitope description:THTCPPCP antigen name:Immunoglobulin host organism:Homo sapiens antibody name:Mez

Recognition of IgG-derived peptides by a human IgM with an unusual combining site.

ID: 1692530

Description: epitope description:HTCPPCPA antigen name:Immunoglobulin host organism:Homo sapiens antibody name:Mez

Recognition of IgG-derived peptides by a human IgM with an unusual combining site.

ID: 1692541

Description: epitope description:KGQPREPQ antigen name:Immunoglobulin host organism:Homo sapiens antibody name:Mez

Recognition of IgG-derived peptides by a human IgM with an unusual combining site.

ID: 1692543

Description: epitope description:VEWESNGQ antigen name:Immunoglobulin host organism:Homo sapiens antibody name:Mez

Detection of specific IgE antibodies to major and minor antigenic determinants in sera of penicillin allergic patients.

ID: 1688478

Description: epitope description:benzylpenicillin host organism:Homo sapiens

Detection of specific IgE antibodies to major and minor antigenic determinants in sera of penicillin allergic patients.

ID: 1688505

Description: epitope description:2,5,5-trimethyl-1,3-thiazolidine-4-carboxylic acid host organism:Homo sapiens

Detection of specific IgE antibodies to major and minor antigenic determinants in sera of penicillin allergic patients.

ID: 1688506

Description: epitope description:phenylacetic acid host organism:Homo sapiens

Detection of specific IgE antibodies to major and minor antigenic determinants in sera of penicillin allergic patients.

ID: 1688538

Description: epitope description:N-phenylglycine host organism:Homo sapiens

Detection of specific IgE antibodies to major and minor antigenic determinants in sera of penicillin allergic patients.

ID: 1688550

Description: epitope description:amoxicillin host organism:Homo sapiens

Detection of specific IgE antibodies to major and minor antigenic determinants in sera of penicillin allergic patients.

ID: 1688554

Description: epitope description:N-(p-hydroxyphenyl)glycine host organism:Homo sapiens

An IgM anti-MBP Ab in a case of Waldenstrom's macroglobulinemia with polyneuropathy expressing an idiotype reactive with an MBP epitope immunodominant...

ID: 1688577

Description: epitope description:VHFFKNIVTPRTP antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

An IgM anti-MBP Ab in a case of Waldenstrom's macroglobulinemia with polyneuropathy expressing an idiotype reactive with an MBP epitope immunodominant...

ID: 1688584

Description: epitope description:TPRTPPPSQGKGRGLSLSRFSWGA antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

An IgM anti-MBP Ab in a case of Waldenstrom's macroglobulinemia with polyneuropathy expressing an idiotype reactive with an MBP epitope immunodominant...

ID: 1688589

Description: epitope description:RFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVH antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

An IgM anti-MBP Ab in a case of Waldenstrom's macroglobulinemia with polyneuropathy expressing an idiotype reactive with an MBP epitope immunodominant...

ID: 1688596

Description: epitope description:TPRTPPPSQGKGRGLSLSRFSWGA antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens

Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

ID: 1688699

Description: epitope description:GSLPQKAQRPQDENG host organism:Rattus norvegicus Lewis antibody name:HLR-1, HLR-2, HLR-3, HLR-4, HLR-5.

Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

ID: 1688701

Description: epitope description:GSLPQKAQRPQDENG host organism:Rattus norvegicus Lewis antibody name:HLR-6.

Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

ID: 1688702

Description: epitope description:GSLPQKAQRPQDENG host organism:Rattus norvegicus Lewis antibody name:HLR-2

Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

ID: 1688737

Description: epitope description:GSLPQKAQRPQDENG host organism:Rattus norvegicus Lewis antibody name:HLR-6

Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

ID: 1688738

Description: epitope description:YGSLPQKAQRPQDENG host organism:Rattus norvegicus Lewis antibody name:HLR-6

The epitope study of alpha-fodrin autoantibody in primary Sjögren's syndrome.

ID: 1689198

Description: epitope description:MDPSGVKVLETAE antigen name:Spectrin alpha chain, non-erythrocytic 1 host organism:Homo sapiens

Immunochemical analysis of Lewis rat antisera to the synthetic encephalitogenic peptide S49.

ID: 1689201

Description: epitope description:GSLPQKAQGHRPQDEN antigen name:Myelin basic protein host organism:Rattus norvegicus Lewis antibody name:HLR-1, HLR-2, HLR-3, HLR-4,...

The epitope study of alpha-fodrin autoantibody in primary Sjögren's syndrome.

ID: 1689204

Description: epitope description:QKLEDSYRFQFFQ antigen name:Spectrin alpha chain, non-erythrocytic 1 host organism:Homo sapiens

The epitope study of alpha-fodrin autoantibody in primary Sjögren's syndrome.

ID: 1689206

Description: epitope description:FQFFQRDAEELEKW antigen name:Spectrin alpha chain, non-erythrocytic 1 host organism:Homo sapiens

Structural, molecular and immunological properties of linear B-cell epitopes of Ro60KD autoantigen.

ID: 1689217

Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Anti-NMDA receptor autoantibodies in patients with systemic lupus erythematosus and their first-degree relatives.

ID: 1689220

Description: epitope description:DWEYSVWLSN antigen name:Glutamate receptor ionotropic, NMDA 2A host organism:Homo sapiens

Structural, molecular and immunological properties of linear B-cell epitopes of Ro60KD autoantigen.

ID: 1689223

Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Structural, molecular and immunological properties of linear B-cell epitopes of Ro60KD autoantigen.

ID: 1689225

Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Structural, molecular and immunological properties of linear B-cell epitopes of Ro60KD autoantigen.

ID: 1689229

Description: epitope description:RPDAEYWNSQKDLLEQKRGR antigen name:HLA class II histocompatibility antigen, DRB1-3 chain host organism:Homo sapiens

Structural, molecular and immunological properties of linear B-cell epitopes of Ro60KD autoantigen.

ID: 1689231

Description: epitope description:RPDAEYWNSQKDLLEQKRGR antigen name:HLA class II histocompatibility antigen, DRB1-3 chain host organism:Homo sapiens

A major autoepitope is present on the amino terminus of a human SS-A/Ro polypeptide.

ID: 1689233

Description: epitope description:KEQFLDGDGWTSRWIESK antigen name:Calreticulin host organism:Homo sapiens

Human T-cell lymphotropic virus (HTLV)-related endogenous sequence, HRES-1, encodes a 28-kDa protein: a possible autoantigen for HTLV-I gag-reactive a...

ID: 1689254

Description: epitope description:PTRAPSGPRPP antigen name:Putative HTLV-1-related endogenous sequence host organism:Oryctolagus cuniculus antibody name:Ab 232

Human T-cell lymphotropic virus (HTLV)-related endogenous sequence, HRES-1, encodes a 28-kDa protein: a possible autoantigen for HTLV-I gag-reactive a...

ID: 1689255

Description: epitope description:PTRAPSGPRPP antigen name:Putative HTLV-1-related endogenous sequence host organism:Oryctolagus cuniculus antibody name:Ab 232

Human T-cell lymphotropic virus (HTLV)-related endogenous sequence, HRES-1, encodes a 28-kDa protein: a possible autoantigen for HTLV-I gag-reactive a...

ID: 1689261

Description: epitope description:PTRAPSGPRPP antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

Human T-cell lymphotropic virus (HTLV)-related endogenous sequence, HRES-1, encodes a 28-kDa protein: a possible autoantigen for HTLV-I gag-reactive a...

ID: 1689277

Description: epitope description:RRREGPDRSPR antigen name:Putative HTLV-1-related endogenous sequence host organism:Homo sapiens

A major autoepitope is present on the amino terminus of a human SS-A/Ro polypeptide.

ID: 1689354

Description: epitope description:KEQFLDGDGWTSRWIESK antigen name:Calreticulin host organism:Homo sapiens

Anticardiolipin antibodies in autoimmune thrombocytopenic purpura.

ID: 1689365

Description: epitope description:cardiolipin host organism:Homo sapiens antibody name:Human sera

IgG antibodies from patients with primary Sjögren's syndrome and systemic lupus erythematosus recognize different epitopes in 60-kD SSA/Ro protei...

ID: 1689373

Description: epitope description:MEESVNQMQPLNEKQIANSQDGY antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

IgG antibodies from patients with primary Sjögren's syndrome and systemic lupus erythematosus recognize different epitopes in 60-kD SSA/Ro protei...

ID: 1689391

Description: epitope description:DGYVWQVTDMNRLHRFLCFGS antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

IgG antibodies from patients with primary Sjögren's syndrome and systemic lupus erythematosus recognize different epitopes in 60-kD SSA/Ro protei...

ID: 1689396

Description: epitope description:VCEKLCNEKLLKKARIHPFHI antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

IgG antibodies from patients with primary Sjögren's syndrome and systemic lupus erythematosus recognize different epitopes in 60-kD SSA/Ro protei...

ID: 1689400

Description: epitope description:KLIVCGMTSNGFTIADPDDRGMLD antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Mapping of epitopes on the 86 kDa subunit of the Ku autoantigen.

ID: 1689617

Description: epitope description:EEAKKFLAPK antigen name:X-ray repair cross-complementing protein 5 host organism:Mus musculus BALB/c antibody name:RZ-2, 2D-9

Anticardiolipin antibodies: detection by radioimmunoassay and association with thrombosis in systemic lupus erythematosus.

ID: 1689627

Description: epitope description:cardiolipin host organism:Homo sapiens antibody name:Human sera

The value of synthetic linear epitope analogues of La/SSB for the detection of autoantibodies to La/SSB; specificity, sensitivity and comparison of me...

ID: 1689667

Description: epitope description:TLHKAFKGSIFVVFDSIESA antigen name:Lupus La protein host organism:Homo sapiens

The value of synthetic linear epitope analogues of La/SSB for the detection of autoantibodies to La/SSB; specificity, sensitivity and comparison of me...

ID: 1689693

Description: epitope description:GSGKGKVQFQGKKTKF antigen name:Lupus La protein host organism:Homo sapiens

Preferential recognition of the phosphorylated major linear B-cell epitope of La/SSB 349-368 aa by anti-La/SSB autoantibodies from patients with syste...

ID: 1689747

Description: epitope description:GSGKGKVQFQGKKTKF antigen name:Lupus La protein host organism:Homo sapiens

The value of synthetic linear epitope analogues of La/SSB for the detection of autoantibodies to La/SSB; specificity, sensitivity and comparison of me...

ID: 1689822

Description: epitope description:VTWEVLEGEVEKEALKKI antigen name:Lupus La protein host organism:Homo sapiens

Post-translational modifications of the major linear epitope 169-190aa of Ro60 kDa autoantigen alter the autoantibody binding.

ID: 1689824

Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Post-translational modifications of the major linear epitope 169-190aa of Ro60 kDa autoantigen alter the autoantibody binding.

ID: 1689832

Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP + CITR(R6, R16) antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Post-translational modifications of the major linear epitope 169-190aa of Ro60 kDa autoantigen alter the autoantibody binding.

ID: 1689834

Description: epitope description:TKYKQRNGWSHKDLLRLSHLKP + CITR(R6, R16) antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

Induction of autoimmunity by multivalent immunodominant and subdominant T cell determinants of La (SS-B).

ID: 1689842

Description: epitope description:NANNGNLQLRNKEVT antigen name:Lupus La protein homolog host organism:Mus musculus A/J

Induction of autoimmunity by multivalent immunodominant and subdominant T cell determinants of La (SS-B).

ID: 1689843

Description: epitope description:NANNGNLQLRNKEVT antigen name:Lupus La protein homolog host organism:Mus musculus A/J

A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

ID: 1689850

Description: epitope description:VRFLMKLSHETVT antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

ID: 1689882

Description: epitope description:RGRGRGRGRGRGR antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

ID: 1689902

Description: epitope description:ETVTIELKNGTQV antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

ID: 1689907

Description: epitope description:TITGVDVSMNTHL antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

ID: 1689917

Description: epitope description:LSIRGNRIRYFIL antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

ID: 1689920

Description: epitope description:YFILPDSLPLDTI antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

ID: 1689922

Description: epitope description:SLPLDTIRVDVEP antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

ID: 1689926

Description: epitope description:VEPKVKSKKREAV antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

A novel epitope on the C-terminus of SmD1 is recognized by the majority of sera from patients with systemic lupus erythematosus.

ID: 1689932

Description: epitope description:GRGRGRGRGRGRG antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens