Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Identification of a crucial energetic footprint on the alpha1 helix of human histocompatibility leukocyte antigen (HLA)-A2 that provides functional in...

    ID: 3465634

    Description: epitope description:LLFGYPVYV antigen name:Protein Tax-1 host organism:Homo sapiens t cell receptor:A6 mhc allele name:HLA-A*02:01 W167A mutant

    Publication: 11238586;

  2. Identification of a crucial energetic footprint on the alpha1 helix of human histocompatibility leukocyte antigen (HLA)-A2 that provides functional in...

    ID: 3465644

    Description: epitope description:LLFGYPVYV antigen name:Protein Tax-1 host organism:Homo sapiens t cell receptor:A6 mhc allele name:HLA-A*02:01 T163A mutant

    Publication: 11238586;

  3. Identification of a crucial energetic footprint on the alpha1 helix of human histocompatibility leukocyte antigen (HLA)-A2 that provides functional in...

    ID: 3465645

    Description: epitope description:LLFGYPVYV antigen name:Protein Tax-1 host organism:Homo sapiens t cell receptor:A6 mhc allele name:HLA-A*02:01 E166A mutant

    Publication: 11238586;

  4. Prominent usage of V beta 8.3 T cells in the H-2Db-restricted response to an influenza A virus nucleoprotein epitope.

    ID: 3465783

    Description: epitope description:IASNENMETMESSTLE antigen name:Nucleoprotein host organism:Mus musculus C57BL/6 t cell receptor:7.9.3.28, 7.12.4, 7.7, 12.33, 12.91...

    Publication: 7689611;

  5. A highly tilted binding mode by a self-reactive T cell receptor results in altered engagement of peptide and MHC.

    ID: 3465803

    Description: epitope description:ENPVVHFFKNIVTPR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens t cell receptor:Hy.1B11 alpha chain ...

    Publication: 21199956;

  6. Structure of a TCR with high affinity for self-antigen reveals basis for escape from negative selection.

    ID: 3465807

    Description: epitope description:FSWGAEGQRPGFG antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens t cell receptor:MS2-3C8 mhc allele nam...

    Publication: 21297580;

  7. Structure of a TCR with high affinity for self-antigen reveals basis for escape from negative selection.

    ID: 3465809

    Description: epitope description:FSWGAEGQRPGFG antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens t cell receptor:MS2-3C8 T29A alpha-cha...

    Publication: 21297580;

  8. Involvement of both T cell receptor V alpha and V beta variable region domains and alpha chain junctional region in viral antigen recognition.

    ID: 3466157

    Description: epitope description:IKAVYNFATCG antigen name:Pre-glycoprotein polyprotein GP complex host organism:Mus musculus P14 TCR Tg t cell receptor:P14 mhc all...

    Publication: 1716213;

  9. Dual non-contiguous peptide occupancy of HLA class I evoke antiviral human CD8 T cell response and form neo-epitopes with self-antigens.

    ID: 3466620

    Description: epitope description:SSCSSCPLS antigen name:Latent membrane protein 2 host organism:Homo sapiens mhc allele name:HLA-A*11:01

    Publication: 28698575;

  10. Dual non-contiguous peptide occupancy of HLA class I evoke antiviral human CD8 T cell response and form neo-epitopes with self-antigens.

    ID: 3466626

    Description: epitope description:SCPLSK antigen name:Latent membrane protein 2 host organism:Homo sapiens mhc allele name:HLA-A*11:01

    Publication: 28698575;

  11. Dual non-contiguous peptide occupancy of HLA class I evoke antiviral human CD8 T cell response and form neo-epitopes with self-antigens.

    ID: 3466628

    Description: epitope description:SSCSSCPL antigen name:Latent membrane protein 2 host organism:Homo sapiens mhc allele name:HLA-A*11:01

    Publication: 28698575;

  12. Dual non-contiguous peptide occupancy of HLA class I evoke antiviral human CD8 T cell response and form neo-epitopes with self-antigens.

    ID: 3466635

    Description: epitope description:SSCSSCPLSK antigen name:Latent membrane protein 2 host organism:Homo sapiens mhc allele name:HLA-A*11:01

    Publication: 28698575;

  13. Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).

    ID: 3466805

    Description: epitope description:ANERADLIAYLEQATK host organism:Mus musculus t cell receptor:226 mhc allele name:H2-IEk

    Publication: 21490152;

  14. Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).

    ID: 3466816

    Description: epitope description:ANERADLIAYLKQATK antigen name:Manduca sexta (hornblower) protein host organism:Mus musculus B10.A t cell receptor:2B4 betaL96P mut...

    Publication: 21490152;

  15. Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).

    ID: 3466817

    Description: epitope description:ANERADLIAYLKQATK antigen name:Manduca sexta (hornblower) protein host organism:Mus musculus B10.A t cell receptor:2B4 betaL96P mut...

    Publication: 21490152;

  16. Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).

    ID: 3466818

    Description: epitope description:ANERADLIAYLKQATK antigen name:Manduca sexta (hornblower) protein host organism:Mus musculus B10.A t cell receptor:2B4 betaL96P mut...

    Publication: 21490152;

  17. Homologous HSV1 and alpha-synuclein peptides stimulate a T cell response in Parkinson's disease.

    ID: 3466819

    Description: epitope description:LGKNEEGAPQEGILE antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class I

    Publication: 28778441;

  18. Homologous HSV1 and alpha-synuclein peptides stimulate a T cell response in Parkinson's disease.

    ID: 3466825

    Description: epitope description:LGKNEEGAPQEGILE antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28778441;

  19. T cell allorecognition via molecular mimicry.

    ID: 3466885

    Description: epitope description:EEYLKAWTF host organism:Homo sapiens t cell receptor:LC13 mhc allele name:HLA-B*44:05

    Publication: 20064448;

  20. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3466957

    Description: epitope description:MPVDPDNEAYEMPSE + NIT(Y10) antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  21. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3466975

    Description: epitope description:AGKTKEGVLYVGSKT antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  22. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3466976

    Description: epitope description:AGSIAAATGF antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  23. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3466981

    Description: epitope description:AKEGVVAAAEKTKQG antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  24. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3466985

    Description: epitope description:APGKTKEGVL antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  25. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3466986

    Description: epitope description:APQEGILEDM antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 28636593;

  26. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3466988

    Description: epitope description:ATGFVKKDQLGKNEE antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 28636593;

  27. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3466994

    Description: epitope description:ATVAEKTKEQVTNVG antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  28. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467005

    Description: epitope description:DNEAYEMPSE antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  29. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467007

    Description: epitope description:DNEAYEMPSEEGYQD antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA-DQB1*05:01

    Publication: 28636593;

  30. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467022

    Description: epitope description:DVFMKGLSKA antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 28636593;

  31. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467038

    Description: epitope description:EMPSEEGYQDYEPEA antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  32. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467055

    Description: epitope description:FMKGLSKAK antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  33. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467059

    Description: epitope description:FVKKDQLGK antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  34. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467064

    Description: epitope description:GAVVTGVTAV antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  35. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467066

    Description: epitope description:GILEDMPVDPDNEAY antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 28636593;

  36. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467070

    Description: epitope description:GKNEEGAPQEGILED antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 28636593;

  37. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467081

    Description: epitope description:GSIAAATGFV antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  38. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467084

    Description: epitope description:GSIAAATGFVKKDQL antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  39. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467085

    Description: epitope description:GSIAAATGFVKKDQL antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  40. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467092

    Description: epitope description:GVAEAPGKTK antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  41. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467094

    Description: epitope description:GVATVAEKTKEQVTN antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  42. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467098

    Description: epitope description:GVLYVGSKTK antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  43. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467099

    Description: epitope description:GVLYVGSKTK antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  44. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467106

    Description: epitope description:GVVAAAEKTK antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 28636593;

  45. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467110

    Description: epitope description:GVVHGVTTV antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  46. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467144

    Description: epitope description:KTKEQVTNV antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  47. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467145

    Description: epitope description:KTKEQVTNV antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  48. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467152

    Description: epitope description:KTKQGVAEAA antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 28636593;

  49. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467154

    Description: epitope description:KTKQGVAEAAGKTKE antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  50. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467161

    Description: epitope description:LYVGSKTKEG antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  51. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467165

    Description: epitope description:MDVFMKGLSKAKEGV antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  52. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467168

    Description: epitope description:MPSEEGYQD antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 28636593;

  53. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467172

    Description: epitope description:MPVDPDNEA antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 28636593;

  54. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467179

    Description: epitope description:MPVDPDNEAYEMPSE antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  55. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467195

    Description: epitope description:PSEEGYQDY antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  56. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467199

    Description: epitope description:QEGILEDMPV antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  57. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467215

    Description: epitope description:SEEGYQDYEP antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  58. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467218

    Description: epitope description:SIAAATGFVK antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  59. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467221

    Description: epitope description:DNEAYEMPSEEGYQD + PHOS(S9) antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA-DQB1*05:01

    Publication: 28636593;

  60. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467222

    Description: epitope description:DNEAYEMPSEEGYQD + PHOS(S9) antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA-DQB1*05:01

    Publication: 28636593;

  61. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467225

    Description: epitope description:DNEAYEMPSEEGYQD + NIT(Y5, Y13) antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  62. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467228

    Description: epitope description:EMPSEEGYQDYEPEA + PHOS(S4) antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  63. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467237

    Description: epitope description:TVEGAGSIAAATGFV antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  64. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467257

    Description: epitope description:VGGAVVTGVTAVAQK antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  65. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467258

    Description: epitope description:VLYVGSKTK antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  66. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467262

    Description: epitope description:VTGVTAVAQKTVEGA antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 28636593;

  67. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467263

    Description: epitope description:VTGVTAVAQKTVEGA antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  68. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467270

    Description: epitope description:YEMPSEEGYQ antigen name:Alpha-synuclein host organism:Homo sapiens

    Publication: 28636593;

  69. T cells from patients with Parkinson's disease recognize ?-synuclein peptides.

    ID: 3467271

    Description: epitope description:YEMPSEEGYQ antigen name:Alpha-synuclein host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 28636593;

  70. Alphabeta T cell receptor interactions with syngeneic and allogeneic ligands: affinity measurements and crystallization.

    ID: 3467279

    Description: epitope description:LSPFPFDL antigen name:2-oxoglutarate dehydrogenase, mitochondrial host organism:Mus musculus BALB.B t cell receptor:2C mhc allele ...

    Publication: 9391114;

  71. Alphabeta T cell receptor interactions with syngeneic and allogeneic ligands: affinity measurements and crystallization.

    ID: 3467282

    Description: epitope description:EQYKFYSV antigen name:Cytochrome c oxidase subunit NDUFA4 host organism:Mus musculus BALB.B t cell receptor:2C mhc allele name:H2-...

    Publication: 9391114;

  72. Alphabeta T cell receptor interactions with syngeneic and allogeneic ligands: affinity measurements and crystallization.

    ID: 3467287

    Description: epitope description:SIYRYYGL host organism:Mus musculus BALB.B t cell receptor:2C mhc allele name:H2-Kb

    Publication: 9391114;

  73. Four A6-TCR/peptide/HLA-A2 structures that generate very different T cell signals are nearly identical.

    ID: 3467300

    Description: epitope description:LLFGYPVYV antigen name:Protein Tax-1 host organism:Homo sapiens t cell receptor:A6 mhc allele name:HLA-A*02:01

    Publication: 10435578;

  74. High affinity xenoreactive TCR:MHC interaction recruits CD8 in absence of binding to MHC.

    ID: 3467322

    Description: epitope description:ALWGFFPVL antigen name:ER membrane protein complex subunit 7 host organism:Mus musculus C57BL/6 t cell receptor:AHIII 12.2 mhc all...

    Publication: 12496422;

  75. Circumventing tolerance to a human MDM2-derived tumor antigen by TCR gene transfer.

    ID: 3467573

    Description: epitope description:LLGDLFGV antigen name:E3 ubiquitin-protein ligase Mdm2 (UniProt:Q00987) host organism:Mus musculus C57BL/6 HLA-A*0201 Tg human CD8...

    Publication: 11577350;

  76. Fixed expression of single influenza virus-specific TCR chains demonstrates the capacity for TCR alpha- and beta-chain diversity in the face of peptid...

    ID: 3467581

    Description: epitope description:SSLENFRAYV antigen name:Polymerase acidic protein host organism:Mus musculus 6218 TCR Tg t cell receptor:PAbeta 6218 TCR mhc allel...

    Publication: 25535284;

  77. Two different T cell receptors use different thermodynamic strategies to recognize the same peptide/MHC ligand.

    ID: 3467647

    Description: epitope description:LLFGYPVYV antigen name:Protein Tax-1 host organism:Homo sapiens t cell receptor:A6 mhc allele name:HLA-A*02:01

    Publication: 15670602;

  78. Two different T cell receptors use different thermodynamic strategies to recognize the same peptide/MHC ligand.

    ID: 3467649

    Description: epitope description:LLFGYPVYV antigen name:Protein Tax-1 host organism:Homo sapiens t cell receptor:A6 mhc allele name:HLA-A*02:01

    Publication: 15670602;

  79. Circumventing tolerance to a human MDM2-derived tumor antigen by TCR gene transfer.

    ID: 3467692

    Description: epitope description:LLGDLFGV antigen name:E3 ubiquitin-protein ligase Mdm2 (UniProt:Q00987) host organism:Homo sapiens t cell receptor:clone 8e mhc al...

    Publication: 11577350;

  80. Narrowing of human influenza A virus-specific T cell receptor alpha and beta repertoires with increasing age.

    ID: 3467694

    Description: epitope description:GILGFVFTL antigen name:Matrix protein 1 host organism:Homo sapiens mhc allele name:HLA-A*02:01

    Publication: 25609818;

  81. Fixed expression of single influenza virus-specific TCR chains demonstrates the capacity for TCR alpha- and beta-chain diversity in the face of peptid...

    ID: 3467711

    Description: epitope description:SSLENFRAYV antigen name:Polymerase acidic protein host organism:Mus musculus 6218 TCR Tg t cell receptor:PAbeta 6218 TCR mhc allel...

    Publication: 25535284;

  82. Induction of diabetes in standard mice by immunization with the p277 peptide of a 60-kDa heat shock protein.

    ID: 3467743

    Description: epitope description:VLGGGCALLRCIPALDSLTPANED antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Mus musculus C57BL/6...

    Publication: 7589082;

  83. Induction of diabetes in standard mice by immunization with the p277 peptide of a 60-kDa heat shock protein.

    ID: 3467747

    Description: epitope description:VLGGGCALLRCIPALDSLTPANED antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Mus musculus C57BL/6

    Publication: 7589082;

  84. Metabolic and immune effects of immunotherapy with proinsulin peptide in human new-onset type 1 diabetes.

    ID: 3467977

    Description: epitope description:HLVEALYLV antigen name:Insulin (UniProt:P01308) host organism:Homo sapiens mhc allele name:HLA-A*02:01

    Publication: 28794283;

  85. Metabolic and immune effects of immunotherapy with proinsulin peptide in human new-onset type 1 diabetes.

    ID: 3467980

    Description: epitope description:GSLQPLALEGSLQKRGIV antigen name:Insulin (UniProt:P01308) host organism:Homo sapiens mhc allele name:HLA-A*02:01

    Publication: 28794283;

  86. Metabolic and immune effects of immunotherapy with proinsulin peptide in human new-onset type 1 diabetes.

    ID: 3467982

    Description: epitope description:GSLQPLALEGSLQKRGIV antigen name:Insulin (UniProt:P01308) host organism:Homo sapiens mhc allele name:HLA-DRB1*04:01

    Publication: 28794283;

  87. Characterization of the Syk-Dependent T Cell Signaling Response to an Altered Peptide.

    ID: 3467991

    Description: epitope description:GEPGIAGFKGEQGPKGEPGP + HYL(P3, P18) antigen name:Collagen alpha-1(II) chain host organism:Mus musculus qCII24 TCR Tg mhc allele na...

    Publication: 27837109;

  88. Characterization of the Syk-Dependent T Cell Signaling Response to an Altered Peptide.

    ID: 3467995

    Description: epitope description:GEPGAPGNKGEQGPKGEPGP + HYL(P3, P6, P18) host organism:Mus musculus qCII24 TCR Tg mhc allele name:H2-IAq

    Publication: 27837109;

  89. Characterization of the Syk-Dependent T Cell Signaling Response to an Altered Peptide.

    ID: 3467998

    Description: epitope description:GEPGAPGNKGEQGPKGEPGP + HYL(P3, P6, P18) host organism:Mus musculus qCII24 TCR Tg mhc allele name:H2-IAq

    Publication: 27837109;

  90. Repertoire dynamics of autoreactive T cells in multiple sclerosis patients and healthy subjects: epitope spreading versus clonal persistence.

    ID: 3468012

    Description: epitope description:ENPVVHFFKNIVTPR antigen name:Myelin basic protein (UniProt:P02686) host organism:Homo sapiens mhc allele name:HLA-DRB3*02:02

    Publication: 10686174;

  91. NY-ESO-1 TCR single edited stem and central memory T cells to treat multiple myeloma without graft-versus-host disease.

    ID: 3468059

    Description: epitope description:SLLMWITQC antigen name:Cancer/testis antigen 1 host organism:Homo sapiens t cell receptor:IG4 mhc allele name:HLA-A*02:01

    Publication: 28637663;

  92. Persistence of autoreactive myelin oligodendrocyte glycoprotein (MOG)-specific T cell repertoires in MOG-expressing mice.

    ID: 3468128

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Mus musculus C57BL/6 mhc allele name:H2-b cla...

    Publication: 16506290;

  93. Persistence of autoreactive myelin oligodendrocyte glycoprotein (MOG)-specific T cell repertoires in MOG-expressing mice.

    ID: 3468143

    Description: epitope description:MEVGWYRSPFARVVHL host organism:Mus musculus C57BL/6 t cell receptor:32.2 mhc allele name:H2-IAb

    Publication: 16506290;

  94. Persistence of autoreactive myelin oligodendrocyte glycoprotein (MOG)-specific T cell repertoires in MOG-expressing mice.

    ID: 3468150

    Description: epitope description:MEAGWYRSPFSRVVHL host organism:Mus musculus C57BL/6 t cell receptor:32.2 mhc allele name:H2-IAb

    Publication: 16506290;

  95. Tackling Bet v 1 and associated food allergies with a single hybrid protein.

    ID: 3468209

    Description: epitope description:NEIKIVATPDGGSILKISNKYHTKGDHEVKAEQV antigen name:Bet v 1 host organism:Homo sapiens mhc allele name:HLA class II

    Publication: 27939703;

  96. Structural and kinetic basis for heightened immunogenicity of T cell vaccines.

    ID: 3468275

    Description: epitope description:SLLMWITQV host organism:Homo sapiens t cell receptor:1G4 mhc allele name:HLA-A*02:01

    Publication: 15837811;

  97. T-cell Responses in Individuals Infected with Zika Virus and in Those Vaccinated Against Dengue Virus.

    ID: 3468293

    Description: epitope description:VMAQDKPTVDIELVT antigen name:Zika virus protein host organism:Homo sapiens mhc allele name:HLA-A2

    Publication: 28835931;

  98. T-cell Responses in Individuals Infected with Zika Virus and in Those Vaccinated Against Dengue Virus.

    ID: 3468298

    Description: epitope description:RLKGVSYSLCTAAFTF antigen name:Zika virus protein host organism:Homo sapiens mhc allele name:HLA-A2

    Publication: 28835931;

  99. T-cell Responses in Individuals Infected with Zika Virus and in Those Vaccinated Against Dengue Virus.

    ID: 3468300

    Description: epitope description:TMNNKHWLVHKEWFH antigen name:Zika virus protein host organism:Homo sapiens mhc allele name:HLA-A2

    Publication: 28835931;

  100. T-cell Responses in Individuals Infected with Zika Virus and in Those Vaccinated Against Dengue Virus.

    ID: 3468309

    Description: epitope description:RLITANPVITESTEN antigen name:Zika virus protein host organism:Homo sapiens mhc allele name:HLA-A2

    Publication: 28835931;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston