Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.

    ID: 1477963

    Description: epitope description:TVDASSGSNRFAALPAFGKPAVWGPQGAGYFYQYNSTH antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:5G10

    Publication: 18198381;

  2. Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.

    ID: 1477967

    Description: epitope description:HQEWIYFLQNGSSVVWYAYTNMLGQKSDTSILFEVRPIQASDQPWFLAHHTGGDDCTT antigen name:Capsid protein host organism:Mus musculus BALB/c antibody ...

    Publication: 18198381;

  3. Identification of two neutralization epitopes on the capsid protein of avian hepatitis E virus.

    ID: 1477968

    Description: epitope description:HQEWIYFLQNGSSVVWYAYTNMLGQKSDTSILFEVRPIQASDQPWFLAHHTGGDDCTT antigen name:Capsid protein host organism:Mus musculus BALB/c antibody ...

    Publication: 18198381;

  4. Identification of aleutian mink disease parvovirus capsid sequences mediating antibody-dependent enhancement of infection, virus neutralization, and i...

    ID: 1477983

    Description: epitope description:EQELNFPHEVLDDAA antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus

    Publication: 11602751;

  5. Vaccines prepared from chimeras of foot-and-mouth disease virus (FMDV) induce neutralizing antibodies and protective immunity to multiple serotypes of...

    ID: 1477991

    Description: epitope description:T678, T681 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2PD11

    Publication: 7523697;

  6. A peptide construct containing B-cell and T-cell epitopes from the foot-and-mouth disease viral VP1 protein induces efficient antiviral protection.

    ID: 1482066

    Description: epitope description:KYSAGGMGRRGDLEPLAARVAAQL antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 10075164;

  7. Localization of T and B cell stimulating domains of the immunodominant 33-kDa protein of Onchocerca volvulus (Ov33).

    ID: 1482091

    Description: epitope description:QKYLSSTIQKQVD antigen name:Immunodominant antigen Ov33-3 host organism:Homo sapiens antibody name:Human sera

    Publication: 9325070;

  8. A peptide construct containing B-cell and T-cell epitopes from the foot-and-mouth disease viral VP1 protein induces efficient antiviral protection.

    ID: 1482110

    Description: epitope description:TTIHELLVRMKRAELYCPR antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 10075164;

  9. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482116

    Description: epitope description:LEQPVSNDLS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  10. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482119

    Description: epitope description:DLYKSNHNNV antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  11. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482130

    Description: epitope description:DSESGGHITH antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  12. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482132

    Description: epitope description:KDNPHPKGSR antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  13. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482136

    Description: epitope description:EKPNLSSKRSE antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  14. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482137

    Description: epitope description:LEQPVSNDLS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  15. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482138

    Description: epitope description:PYQGSGKGVS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  16. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482141

    Description: epitope description:DSESGGHITH antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  17. Induction of anti foot and mouth disease virus T and B cell responses in cattle immunized with a peptide representing ten amino acids of VP1.

    ID: 1482145

    Description: epitope description:RYSRNAVPNV antigen name:Polyprotein host organism:Bos taurus Holstein-Friesian

    Publication: 9569465;

  18. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482153

    Description: epitope description:LEQPVSNDLS antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  19. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482157

    Description: epitope description:DSESGGHITH antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;

  20. Antigenicity of the measles virus haemagglutinin studied by using synthetic peptides.

    ID: 1482158

    Description: epitope description:SCTVTREDGT antigen name:Hemagglutinin glycoprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 2471791;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston