Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. B and T cell responses to the spliceosomal heterogeneous nuclear ribonucleoproteins A2 and B1 in normal and lupus mice.

    ID: 1691409

    Description: epitope description:DKIVLQKYHTINGHNAEVRKA antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus MRL

    Publication: 10925319;

  2. B and T cell responses to the spliceosomal heterogeneous nuclear ribonucleoproteins A2 and B1 in normal and lupus mice.

    ID: 1691412

    Description: epitope description:AAMAARPHSIDGRVVEPKRAV antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Mus musculus C57BL/6

    Publication: 10925319;

  3. Identification of a SmD3 epitope with a single symmetrical dimethylation of an arginine residue as a specific target of a subpopulation of anti-Sm ant...

    ID: 1690860

    Description: epitope description:DVEPKVKSKKREAVA antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 15642139;

  4. Identification of a SmD3 epitope with a single symmetrical dimethylation of an arginine residue as a specific target of a subpopulation of anti-Sm ant...

    ID: 1690882

    Description: epitope description:PKVKSKKREAVAGRG antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 15642139;

  5. Identification of a SmD3 epitope with a single symmetrical dimethylation of an arginine residue as a specific target of a subpopulation of anti-Sm ant...

    ID: 1690883

    Description: epitope description:PKVKSKKREAVAGRG + SCM(R8, R14) antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 15642139;

  6. Identification of a SmD3 epitope with a single symmetrical dimethylation of an arginine residue as a specific target of a subpopulation of anti-Sm ant...

    ID: 1690888

    Description: epitope description:KREAVAGRGRGRGRG antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 15642139;

  7. Identification of a SmD3 epitope with a single symmetrical dimethylation of an arginine residue as a specific target of a subpopulation of anti-Sm ant...

    ID: 1690897

    Description: epitope description:GRGRGRGRGRGRGGP + SCM(R2, R4, R6, R8, R10, R12) antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Homo sapiens

    Publication: 15642139;

  8. Picornavirus proteins share antigenic determinants with heat shock proteins 60/65.

    ID: 1690903

    Description: epitope description:KEVPALTAVETGAT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus antibody name:910

    Publication: 11055249;

  9. Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

    ID: 1690918

    Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 9294205;

  10. Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

    ID: 1690922

    Description: epitope description:DDDMGFGLFD antigen name:Other Trypanosoma cruzi protein host organism:Homo sapiens

    Publication: 9294205;

  11. Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

    ID: 1690926

    Description: epitope description:EESDDDMG antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 9294205;

  12. Identification of a SmD3 epitope with a single symmetrical dimethylation of an arginine residue as a specific target of a subpopulation of anti-Sm ant...

    ID: 1690930

    Description: epitope description:VAARGRGRGMGRGNI antigen name:Small nuclear ribonucleoprotein Sm D3 host organism:Homo sapiens

    Publication: 15642139;

  13. Identification of a SmD3 epitope with a single symmetrical dimethylation of an arginine residue as a specific target of a subpopulation of anti-Sm ant...

    ID: 1690931

    Description: epitope description:VAARGRGRGMGRGNI + SCM(R4, R6, R8, R12) antigen name:Small nuclear ribonucleoprotein Sm D3 host organism:Homo sapiens

    Publication: 15642139;

  14. Identification of a SmD3 epitope with a single symmetrical dimethylation of an arginine residue as a specific target of a subpopulation of anti-Sm ant...

    ID: 1690936

    Description: epitope description:RGRGRGMGRGNIFQK antigen name:Small nuclear ribonucleoprotein Sm D3 host organism:Homo sapiens

    Publication: 15642139;

  15. Immunoreactivity between a monoclonal lupus autoantibody and the arginine/aspartic acid repeats within the U1-snRNP 70K autoantigen is conformationall...

    ID: 1690948

    Description: epitope description:RDRDRDRE antigen name:U1 small nuclear ribonucleoprotein 70 kDa host organism:Mus musculus MRL antibody name:2.73

    Publication: 7527219;

  16. Identification of a SmD3 epitope with a single symmetrical dimethylation of an arginine residue as a specific target of a subpopulation of anti-Sm ant...

    ID: 1690972

    Description: epitope description:AARGRGRGMGRGNIF + SCM(R5) antigen name:Small nuclear ribonucleoprotein Sm D3 host organism:Homo sapiens

    Publication: 15642139;

  17. Anti-U1A monoclonal antibodies recognize unique epitope targets of U1A which are involved in the binding of U1 RNA.

    ID: 1690987

    Description: epitope description:QGFPFYDKPMRI antigen name:U1 small nuclear ribonucleoprotein A host organism:Mus musculus BALB/c antibody name:10E3

    Publication: 12203842;

  18. Can B cell epitopes of 60 kDa Ro distinguish systemic lupus erythematosus from Sjögren's syndrome?

    ID: 1691008

    Description: epitope description:YKQRNGWSHKDLLRLSHLKP antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11530996;

  19. Can B cell epitopes of 60 kDa Ro distinguish systemic lupus erythematosus from Sjögren's syndrome?

    ID: 1691012

    Description: epitope description:EKALSVETEKLLKYLEAV antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11530996;

  20. Can B cell epitopes of 60 kDa Ro distinguish systemic lupus erythematosus from Sjögren's syndrome?

    ID: 1691013

    Description: epitope description:EKALSVETEKLLKYLEAV antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 11530996;

  21. High affinity cross-reacting mAb generated by minimal mimicry: implications for the pathogenesis of anti-nuclear autoantibodies and immunosuppression.

    ID: 1691021

    Description: epitope description:PNHPSSSGSFSDADLAD antigen name:CD99 antigen host organism:Mus musculus Biozzi antibody name:0662

    Publication: 9520450;

  22. High affinity cross-reacting mAb generated by minimal mimicry: implications for the pathogenesis of anti-nuclear autoantibodies and immunosuppression.

    ID: 1691022

    Description: epitope description:GSFSDADLAD antigen name:CD99 antigen host organism:Mus musculus antibody name:2E1

    Publication: 9520450;

  23. High affinity cross-reacting mAb generated by minimal mimicry: implications for the pathogenesis of anti-nuclear autoantibodies and immunosuppression.

    ID: 1691024

    Description: epitope description:GSFSDADLAD antigen name:CD99 antigen host organism:Mus musculus antibody name:2E1

    Publication: 9520450;

  24. Reactivity of autoantibodies in systemic lupus erythematosus with synthetic core histone peptides.

    ID: 1691026

    Description: epitope description:PEPAKSAPAPKKGSKKAVTKAQKKD antigen name:Histone H2B type 1 host organism:Homo sapiens

    Publication: 2474514;

  25. Reactivity of autoantibodies in systemic lupus erythematosus with synthetic core histone peptides.

    ID: 1691031

    Description: epitope description:VHPDTGISSKAMGIMN antigen name:Histone H2B type 1 host organism:Homo sapiens

    Publication: 2474514;

  26. Reactivity of autoantibodies in systemic lupus erythematosus with synthetic core histone peptides.

    ID: 1691033

    Description: epitope description:VSEGTKAVTKYTSSK antigen name:Histone H2B type 1 host organism:Homo sapiens

    Publication: 2474514;

  27. Reactivity of autoantibodies in systemic lupus erythematosus with synthetic core histone peptides.

    ID: 1691048

    Description: epitope description:LPKKTESHHKAKGK antigen name:Histone H2A type 1 host organism:Homo sapiens

    Publication: 2474514;

  28. Reactivity of autoantibodies in systemic lupus erythematosus with synthetic core histone peptides.

    ID: 1691049

    Description: epitope description:MSGRGKQGGKARAKA antigen name:Histone H2A type 1 host organism:Homo sapiens

    Publication: 2474514;

  29. Reactivity of autoantibodies in systemic lupus erythematosus with synthetic core histone peptides.

    ID: 1691052

    Description: epitope description:LAIRNDEELNKLLGKV antigen name:Histone H2A type 1 host organism:Homo sapiens

    Publication: 2474514;

  30. Reactivity of autoantibodies in systemic lupus erythematosus with synthetic core histone peptides.

    ID: 1691056

    Description: epitope description:PATGGVKKPHRYRPGT antigen name:Histone H3.1 host organism:Homo sapiens

    Publication: 2474514;

  31. Correlation between chlamydial infection and autoimmune response: molecular mimicry between RNA polymerase major sigma subunit from Chlamydia trachoma...

    ID: 1691422

    Description: epitope description:ELKIKRLRKKFAQKMLRKARRKL antigen name:60S ribosomal protein L7 host organism:Homo sapiens

    Publication: 9842929;

  32. B and T cell immune response to small nuclear ribonucleoprotein particles in lupus mice: autoreactive CD4(+) T cells recognize a T cell epitope locate...

    ID: 1691461

    Description: epitope description:RERKEELRGGGGDMAEPS antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Mus musculus MLR/lpr

    Publication: 10940910;

  33. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1691484

    Description: epitope description:DAYVLLSEKKISSIQSIV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New ...

    Publication: 12702515;

  34. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1691489

    Description: epitope description:ISKGANPVEIRRGVMLAV antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New ...

    Publication: 12702515;

  35. Cross-reactive B-cell epitopes of microbial and human heat shock protein 60/65 in atherosclerosis.

    ID: 1691496

    Description: epitope description:QKIGIEIIKRTLKIPAMT antigen name:60 kDa heat shock protein, mitochondrial (UniProt:P10809) host organism:Oryctolagus cuniculus New ...

    Publication: 12702515;

  36. Isoaspartyl post-translational modification triggers autoimmune responses to self-proteins.

    ID: 1691516

    Description: epitope description:ERADLIAYLKKATNE + SCM(D4, L5) antigen name:Cytochrome c, somatic host organism:Mus musculus B10.A(2R)

    Publication: 10428801;

  37. Isoaspartyl post-translational modification triggers autoimmune responses to self-proteins.

    ID: 1691527

    Description: epitope description:IRYFILPDSLPLDTL antigen name:Small nuclear ribonucleoprotein Sm D1 host organism:Mus musculus B10.A(2R)

    Publication: 10428801;

  38. Antibodies to ribosomal P proteins of Trypanosoma cruzi in Chagas disease possess functional autoreactivity with heart tissue and differ from anti-P a...

    ID: 1691530

    Description: epitope description:EESDDDMGFGLFD antigen name:60S acidic ribosomal protein P2 host organism:Homo sapiens

    Publication: 9294205;

  39. B cell epitopes of the heterogeneous nuclear ribonucleoprotein A2: identification of a new specific antibody marker for active lupus disease.

    ID: 1691539

    Description: epitope description:SFETTEESLRNYYEQWGKLTDC antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Homo sapiens

    Publication: 18495733;

  40. B cell epitopes of the heterogeneous nuclear ribonucleoprotein A2: identification of a new specific antibody marker for active lupus disease.

    ID: 1691546

    Description: epitope description:KIDTIEIITDRQSGKKRGFGFV antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Homo sapiens

    Publication: 18495733;

  41. B cell epitopes of the heterogeneous nuclear ribonucleoprotein A2: identification of a new specific antibody marker for active lupus disease.

    ID: 1691550

    Description: epitope description:QSSRSGRGGNFGFGDSRGGGGN antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Homo sapiens

    Publication: 18495733;

  42. B cell epitopes of the heterogeneous nuclear ribonucleoprotein A2: identification of a new specific antibody marker for active lupus disease.

    ID: 1691555

    Description: epitope description:MEREKEQFRKLFIGGLSFETT antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Homo sapiens

    Publication: 18495733;

  43. B cell epitopes of the heterogeneous nuclear ribonucleoprotein A2: identification of a new specific antibody marker for active lupus disease.

    ID: 1691566

    Description: epitope description:SFETTEESLRNYYEQWGKLTDC antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Homo sapiens

    Publication: 18495733;

  44. B cell epitopes of the heterogeneous nuclear ribonucleoprotein A2: identification of a new specific antibody marker for active lupus disease.

    ID: 1691578

    Description: epitope description:LTDCVVMRDPASKRSRGFGFV antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Homo sapiens

    Publication: 18495733;

  45. B cell epitopes of the heterogeneous nuclear ribonucleoprotein A2: identification of a new specific antibody marker for active lupus disease.

    ID: 1691582

    Description: epitope description:RGFGFVTFSSMAEVDAAMAAR antigen name:Heterogeneous nuclear ribonucleoproteins A2/B1 host organism:Homo sapiens

    Publication: 18495733;

  46. Recognition of IgG-derived peptides by a human IgM with an unusual combining site.

    ID: 1692546

    Description: epitope description:ESNGQPEN antigen name:Immunoglobulin host organism:Homo sapiens antibody name:Mez

    Publication: 11940231;

  47. Recognition of IgG-derived peptides by a human IgM with an unusual combining site.

    ID: 1692550

    Description: epitope description:QPENNYKT antigen name:Immunoglobulin host organism:Homo sapiens antibody name:Mez

    Publication: 11940231;

  48. Recognition of IgG-derived peptides by a human IgM with an unusual combining site.

    ID: 1692557

    Description: epitope description:KSRWQQGN antigen name:Immunoglobulin host organism:Homo sapiens antibody name:Mez

    Publication: 11940231;

  49. Recognition of IgG-derived peptides by a human IgM with an unusual combining site.

    ID: 1692559

    Description: epitope description:RWQQGNVF antigen name:Immunoglobulin host organism:Homo sapiens antibody name:Mez

    Publication: 11940231;

  50. Unmasking the anti-La/SSB response in sera from patients with Sjogren's syndrome by specific blocking of anti-idiotypic antibodies to La/SSB antigenic...

    ID: 1692572

    Description: epitope description:NNGNLQLRNKEVTWEVLEG antigen name:Lupus La protein host organism:Homo sapiens

    Publication: 12428060;

  51. Unmasking the anti-La/SSB response in sera from patients with Sjogren's syndrome by specific blocking of anti-idiotypic antibodies to La/SSB antigenic...

    ID: 1692573

    Description: epitope description:NNGNLQLRNKEVTWEVLEG antigen name:Lupus La protein host organism:Homo sapiens

    Publication: 12428060;

  52. Unmasking the anti-La/SSB response in sera from patients with Sjogren's syndrome by specific blocking of anti-idiotypic antibodies to La/SSB antigenic...

    ID: 1692578

    Description: epitope description:FRFLALKLYFSFTRP host organism:Homo sapiens

    Publication: 12428060;

  53. Phosphorylation of the nuclear form of varicella-zoster virus immediate-early protein 63 by casein kinase II at serine 186.

    ID: 1692584

    Description: epitope description:IEFRDSDAESSDGEDFIVEE antigen name:Transcriptional regulator ICP22 homolog host organism:Mus musculus BALB/c

    Publication: 19759161;

  54. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692678

    Description: epitope description:TVETQNLEGLHH antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  55. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692680

    Description: epitope description:MASAARLTMMWEE antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  56. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692694

    Description: epitope description:RCRLCDEGHGLE antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  57. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692697

    Description: epitope description:VCEHCD antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  58. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692702

    Description: epitope description:HGIIKECT antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  59. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692710

    Description: epitope description:YITTIAGVM antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  60. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692712

    Description: epitope description:YITTIAGVM antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  61. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692716

    Description: epitope description:QVKGFV antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  62. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692717

    Description: epitope description:QVKGFV antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  63. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692718

    Description: epitope description:KVQLLRNWH antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  64. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692721

    Description: epitope description:KVQLLRNWH antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  65. Detection, epitope-mapping and function of anti-Fas autoantibody in patients with silicosis.

    ID: 1692724

    Description: epitope description:NWHQLHGKKEAY antigen name:Tumor necrosis factor receptor superfamily member 6 host organism:Homo sapiens

    Publication: 16108814;

  66. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692736

    Description: epitope description:MWEEVTCPICLDPFVE antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  67. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692740

    Description: epitope description:EEVTCPICLDPFVEPVSIECGHSF antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  68. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692742

    Description: epitope description:EEVTCPICLDPFVEPVSIECGHSF antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  69. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692747

    Description: epitope description:EPVSIECGHSFCQECI antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  70. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692755

    Description: epitope description:ECISQVGKGGGSVCAV antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  71. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692780

    Description: epitope description:AVHGERLHLFCEKDGKALCWVCAQ antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  72. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692783

    Description: epitope description:VHGERLHLFCEKDGKA antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  73. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692785

    Description: epitope description:VHGERLHLFCEKDGKA antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  74. Cross-recognition between histones and La/SSB may account for anti-DNA reactivity in SLE patients.

    ID: 1692791

    Description: epitope description:GSGKGKVQFQGKKTKF + ACET(G1) antigen name:Lupus La protein host organism:Homo sapiens

    Publication: 16178873;

  75. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692821

    Description: epitope description:RADWKKTVETQKSRIHA antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  76. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692842

    Description: epitope description:SQALQELISELDRRCHS antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  77. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692843

    Description: epitope description:CHSSALELLQEVIIV antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  78. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692860

    Description: epitope description:GLKKMLRTCAVHITLD antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  79. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692883

    Description: epitope description:FHSGKHYWEVDVTGKE antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  80. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692888

    Description: epitope description:GKEAWDLGVCRDSVRRKG antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  81. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692903

    Description: epitope description:PQTPLHLQVPPCQVGIFLD antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  82. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692907

    Description: epitope description:PQTPLHLQVPPCQVGIFLD antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  83. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692910

    Description: epitope description:LDYEAGMVSFYNI antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  84. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692915

    Description: epitope description:NITDHGSLIYSFSECAF antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  85. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692917

    Description: epitope description:NITDHGSLIYSFSECAF antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  86. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692920

    Description: epitope description:CAFTGPLRPFFSPGFN antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  87. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692928

    Description: epitope description:CPLNIGSQGSTDY antigen name:E3 ubiquitin-protein ligase TRIM21 host organism:Homo sapiens

    Publication: 16356190;

  88. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692948

    Description: epitope description:VCEKLCNEKLLKKARIHPFHI antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 16356190;

  89. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692953

    Description: epitope description:KLIVCGMTSNGFTIADPDDRGMLD antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 16356190;

  90. 52-kDa Ro/SSA epitopes preferentially recognized by antibodies from mothers of children with neonatal lupus and congenital heart block.

    ID: 1692963

    Description: epitope description:TGALDVIRNFTLDMI antigen name:60 kDa SS-A/Ro ribonucleoprotein host organism:Homo sapiens

    Publication: 16356190;

  91. Epitopes of the p70 and p80 (Ku) lupus autoantigens.

    ID: 1692996

    Description: epitope description:LTLPKVEAMNKRLGSLVDEFKELVYPPDYN antigen name:X-ray repair cross-complementing protein 6 host organism:Mus musculus BALB/c antibody ...

    Publication: 1707916;

  92. Epitopes of the p70 and p80 (Ku) lupus autoantigens.

    ID: 1692997

    Description: epitope description:SEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD antigen name:X-ray repair cross-complementing protein 6 host organism:Mus muscu...

    Publication: 1707916;

  93. A repeated proline-rich sequence in Sm B/B' and N is a dominant epitope recognized by human and murine autoantibodies.

    ID: 1693005

    Description: epitope description:APAMIPP antigen name:Glutamate decarboxylase 1 host organism:Homo sapiens

    Publication: 1708261;

  94. A repeated proline-rich sequence in Sm B/B' and N is a dominant epitope recognized by human and murine autoantibodies.

    ID: 1693006

    Description: epitope description:PPGAMPP antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 1708261;

  95. RNA recognition motif (RRM) of La/SSB: the bridge for interparticle spreading of autoimmune response to U1-RNP.

    ID: 1693030

    Description: epitope description:TLHKAFKGSIFVVFDSIESA antigen name:Lupus La protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19838329;

  96. RNA recognition motif (RRM) of La/SSB: the bridge for interparticle spreading of autoimmune response to U1-RNP.

    ID: 1693031

    Description: epitope description:TLHKAFKGSIFVVFDSIESA antigen name:Lupus La protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19838329;

  97. Mapping of epitopes on U1 snRNP polypeptide A with synthetic peptides and autoimmune sera.

    ID: 1693434

    Description: epitope description:SQFGQILDILVSRSLKMRGQAFVI antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 1717192;

  98. Biological activity of IgE specific for cross-reactive carbohydrate determinants.

    ID: 1693440

    Description: epitope description:alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->6)-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-GlcpNAc antigen name:Aci...

    Publication: 12704374;

  99. Mapping of epitopes on U1 snRNP polypeptide A with synthetic peptides and autoimmune sera.

    ID: 1693443

    Description: epitope description:MAVPETRPNHT antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 1717192;

  100. Mapping of epitopes on U1 snRNP polypeptide A with synthetic peptides and autoimmune sera.

    ID: 1693444

    Description: epitope description:SQFGQILDILVSRSLKMRGQAFVI antigen name:U1 small nuclear ribonucleoprotein A host organism:Homo sapiens

    Publication: 1717192;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston