Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14024

    Description: epitope description:EDPVLAKKVPETFPELKPGE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  2. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14029

    Description: epitope description:FPELKPGESRHTSDHMSIYK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  3. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14031

    Description: epitope description:DHMSIYKFMGRSHFLCTFTF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  4. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14033

    Description: epitope description:HFLCTFTFNSNNKEYTFPIT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  5. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14035

    Description: epitope description:TPVGLAVDTPWVEKESALSI antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  6. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14040

    Description: epitope description:MSRIAAGDLESSVDDPRSEE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  7. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14047

    Description: epitope description:SHIECRKPYKELRLEVGKQR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  8. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14049

    Description: epitope description:PYKELRLEVGKQRLKYAQEE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  9. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14051

    Description: epitope description:QRLKYAQEELSNEVLPPPRK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  10. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14053

    Description: epitope description:VLPPPRKMKGLFSQAKISLF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  11. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14060

    Description: epitope description:LGSINQAMVTRCEPVVCYLY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  12. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14096

    Description: epitope description:RCEPVVCYLYGKRGGGKSLT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  13. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14100

    Description: epitope description:VSGCPMRLNMASLEEKGRHF antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  14. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14116

    Description: epitope description:DSAVAEFFQSFPSGEPSNSK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  15. Antigenic epitopes of the hepatitis A virus polyprotein.

    ID: 14121

    Description: epitope description:GLVRKNLVQFGVGEKNGCVR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 10417261;

  16. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17539

    Description: epitope description:YDKPYYMLNLYDPNKYVDV antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  17. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17541

    Description: epitope description:YDKPYYMLNLYDPNKYVDV antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15950744;

  18. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17555

    Description: epitope description:KKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  19. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17558

    Description: epitope description:KKYASGNKDNIVRNNDRVY antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15950744;

  20. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17563

    Description: epitope description:YRLATNASQAGVEKILSAL antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  21. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17568

    Description: epitope description:ILSALEIPDVGNLSQVVVM antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  22. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17575

    Description: epitope description:NKCKMNLQDNNGNDIGFIG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  23. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17576

    Description: epitope description:NKCKMNLQDNNGNDIGFIG antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  24. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17582

    Description: epitope description:IGFIGFHQFNNIAKLVASN antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus SJL

    Publication: 15950744;

  25. Submolecular recognition profiles in two mouse strains of non-protective and protective antibodies against botulinum neurotoxin A.

    ID: 17587

    Description: epitope description:SRTLGCSWEFIPVDDGWGE antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Mus musculus BALB/c

    Publication: 15950744;

  26. Development of a humanized monoclonal antibody with therapeutic potential against West Nile virus.

    ID: 17594

    Description: epitope description:S592, K593, T616, T618 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:Humanized E16.3

    Publication: 15852016;

  27. Differential expression of domain III neutralizing epitopes on the envelope proteins of West Nile virus strains.

    ID: 17675

    Description: epitope description:K310, L312, T332, A365 antigen name:Genome polyprotein host organism:Mus musculus antibody name:5H10, 5C5, 7H2

    Publication: 15823609;

  28. Tolerance to self gangliosides is the major factor restricting the antibody response to lipopolysaccharide core oligosaccharides in Campylobacter jeju...

    ID: 17696

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc antigen name:alpha-N-acetylneuraminosyl-...

    Publication: 12183547;

  29. Tolerance to self gangliosides is the major factor restricting the antibody response to lipopolysaccharide core oligosaccharides in Campylobacter jeju...

    ID: 17697

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc antigen name:alpha-N-acetylneuraminosyl-...

    Publication: 12183547;

  30. Tolerance to self gangliosides is the major factor restricting the antibody response to lipopolysaccharide core oligosaccharides in Campylobacter jeju...

    ID: 17719

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-Glc antigen name:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetyl...

    Publication: 12183547;

  31. Identification of Genogroup I and Genogroup II broadly reactive epitopes on the norovirus capsid.

    ID: 17797

    Description: epitope description:E472, K514 antigen name:Capsid protein VP1 host organism:Mus musculus BALB/c antibody name:NV3901, NV3912

    Publication: 15919896;

  32. Antibody responses against wild-type yellow fever virus and the 17D vaccine strain: characterization with human monoclonal antibody fragments and neut...

    ID: 17849

    Description: epitope description:N71, T153, T154, D155 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:scFv-7A

    Publication: 15919103;

  33. Autoantigenicity of DFS70 is restricted to the conformational epitope of C-terminal alpha-helical domain.

    ID: 18047

    Description: epitope description:TEISLKDS antigen name:PC4 and SFRS1-interacting protein host organism:Homo sapiens antibody name:anti-DFS70 Ab

    Publication: 15501393;

  34. Synthesis and immunochemical characterization of protein conjugates of carbohydrate and carbohydrate-mimetic peptides as experimental vaccines.

    ID: 18244

    Description: epitope description:S. flexneri Y polysaccharide antigen name:lipopolysaccharide host organism:Mus musculus antibody name:SYA/J6

    Publication: 15186860;

  35. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18255

    Description: epitope description:TEAAILTQQAAQFDQ antigen name:UniProt:B8ZTS2 host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  36. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18271

    Description: epitope description:QAASAALGALGRFDE antigen name:UniProt:B8ZTS2 host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  37. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18280

    Description: epitope description:SIVDKLNRSGGNYTK antigen name:UniProt:B8ZTS2 host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  38. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18282

    Description: epitope description:LNRSGGNYTKTDDEA antigen name:UniProt:B8ZTS2 host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  39. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18294

    Description: epitope description:MAEMKTDAATLAQEA antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  40. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18307

    Description: epitope description:LAQEAGNFERISGDL antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  41. MUC1 mucin-mediated regulation of human T cells.

    ID: 18325

    Description: epitope description:APDTR antigen name:Mucin-1 host organism:Mus musculus CBA X BALB/c antibody name:BC3 anti-MUC1 Ab

    Publication: 15710907;

  42. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18338

    Description: epitope description:KTQIDQVESTAGSLQ antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  43. MUC1 mucin-mediated regulation of human T cells.

    ID: 18339

    Description: epitope description:APDTRP antigen name:Mucin-1 host organism:Mus musculus BALB/c antibody name:SM3 anti-MUC1 Ab

    Publication: 15710907;

  44. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18357

    Description: epitope description:AAGTAAQAAVVRFQE antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  45. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18371

    Description: epitope description:VRFQEAANKQKQELD antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  46. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18379

    Description: epitope description:KQELDEISTNIRQAG antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  47. Comparative analysis of B- and T-cell epitopes of Mycobacterium leprae and Mycobacterium tuberculosis culture filtrate protein 10.

    ID: 18389

    Description: epitope description:VQYSRADEEQQQALS antigen name:ESAT-6-like protein EsxB host organism:Homo sapiens antibody name:Serum

    Publication: 15155617;

  48. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16404

    Description: epitope description:YIIGSTELGLISI antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  49. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16410

    Description: epitope description:KLESSCNFDLHTT antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;

  50. Human and rodent humoral immune responses to Andes virus structural proteins.

    ID: 16412

    Description: epitope description:FDLHTTSMAQKSFTQVEWRKKSDTTDTTNAASTTFEAQT antigen name:Andes orthohantavirus protein host organism:Homo sapiens

    Publication: 15780882;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston