Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "
  1. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482297

    Description: epitope description:RHVNAGSTGPIKSTI antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;
  2. Neutralizing epitopes of type O foot-and-mouth disease virus. II. Mapping three conformational sites with synthetic peptide reagents.

    ID: 1482306

    Description: epitope description:N143, L144, R145, G146, R200, H201, K202, Q203, K204, I205, V206, A207, P208, V209, K210, Q211, T212, L213 antigen name:Genome po...

    Publication: 2471812;
  3. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482314

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;
  4. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482317

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;
  5. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482318

    Description: epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;
  6. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482348

    Description: epitope description:IKSTIRIYFKPKHVK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;
  7. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482353

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;
  8. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482355

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;
  9. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482357

    Description: epitope description:TAYTASARRGDLAHLAAAHARHLPTSFNF antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide

    Publication: 2155177;
  10. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482360

    Description: epitope description:YKPTGTAPRENIRGDLATLAARIASETHIPTTFNY antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:ant...

    Publication: 2155177;
  11. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482364

    Description: epitope description:YKPTGTAPRENIRGDLATLAARIASETHIPTTFNY antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:ant...

    Publication: 2155177;
  12. Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

    ID: 1482377

    Description: epitope description:YGEEPTMRGDRAVLASKVNKQLPTSFNY antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-pepti...

    Publication: 2155177;
  13. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482387

    Description: epitope description:GPTEESVERAMGRVA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7513917;
  14. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482394

    Description: epitope description:IKSTIRIYFKPKHVK antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 7513917;
  15. Identification of serotype-specific and nonserotype-specific B-cell epitopes of coxsackie B virus using synthetic peptides.

    ID: 1482401

    Description: epitope description:GPSNSEQIPALTAVE antigen name:Genome polyprotein host organism:Rattus norvegicus Lewis

    Publication: 7513917;
  16. Linear antigenic and immunogenic regions of the respiratory syncytial virus P protein.

    ID: 1482412

    Description: epitope description:PTPSDNPFSKLYKETIETFD antigen name:Phosphoprotein host organism:Mus musculus antibody name:RS203

    Publication: 8207401;
  17. Linear antigenic and immunogenic regions of the respiratory syncytial virus P protein.

    ID: 1482414

    Description: epitope description:PTPSDNPFSKLYKETIETFD antigen name:Phosphoprotein host organism:Homo sapiens

    Publication: 8207401;
  18. Linear antigenic and immunogenic regions of the respiratory syncytial virus P protein.

    ID: 1482418

    Description: epitope description:EKLNNLLEGNDSDNDLSLEDF antigen name:Phosphoprotein host organism:Homo sapiens

    Publication: 8207401;
  19. Failure to detect evidence of human T-lymphotropic virus (HTLV) type I and type II in blood donors with isolated gag antibodies to HTLV-I/II.

    ID: 1482441

    Description: epitope description:PPSSPTHDPPDSDPQI antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1627806;
  20. Location of neutralizing epitopes defined by monoclonal antibodies generated against the outer capsid polypeptide, VP1, of foot-and-mouth disease viru...

    ID: 1482478

    Description: epitope description:GDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:6HE4, 7SF3

    Publication: 6085200;

Displaying 20 of 1,510,353 results for " "