Location of neutralizing epitopes defined by monoclonal antibodies generated against the outer capsid polypeptide, VP1, of foot-and-mouth disease viru...

ID: 1482481

Description: epitope description:GDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:6HE4, 7SF3

Binding of neutralizing monoclonal antibodies to regions of the fusion protein of respiratory syncytial virus expressed in Escherichia coli.

ID: 1482488

Description: epitope description:PITNDQKK antigen name:Fusion glycoprotein F0 host organism:Mus musculus antibody name:RS348

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482491

Description: epitope description:GSGVRGDFG antigen name:Genome polyprotein host organism:Cavia porcellus

Influence of the C terminus of the small protein subunit of bean pod mottle virus on the antigenicity of the virus determined using monoclonal antibod...

ID: 1482495

Description: epitope description:AFSVPQANARSSENAESSA antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-180-198

Influence of the C terminus of the small protein subunit of bean pod mottle virus on the antigenicity of the virus determined using monoclonal antibod...

ID: 1482499

Description: epitope description:ANARSSENAESSA antigen name:RNA2 polyprotein host organism:Oryctolagus cuniculus antibody name:anti-186-198

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482502

Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482510

Description: epitope description:DFGSLAPRVA antigen name:Genome polyprotein host organism:Cavia porcellus

Priming for and induction of anti-poliovirus neutralizing antibodies by synthetic peptides.

ID: 1482513

Description: epitope description:STTNKDK antigen name:Genome polyprotein host organism:Mus musculus antibody name:1 BM 55-6

Characterization of HTLV envelope seroreactivity in large granular lymphocyte leukemia.

ID: 1482520

Description: epitope description:QEQCRFPNITNSHVSILQERPPLENRVLTGWGLN antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482531

Description: epitope description:NLRGDLQVLA antigen name:Polyprotein host organism:Cavia porcellus

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482539

Description: epitope description:DLQVLAQKVA antigen name:Polyprotein host organism:Cavia porcellus

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482544

Description: epitope description:VLAQKVARTL antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482558

Description: epitope description:PNLRGDLQVL antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482559

Description: epitope description:NLRGDLQVLA antigen name:Polyprotein host organism:Cavia porcellus

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482560

Description: epitope description:NLRGDLQVLA antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482564

Description: epitope description:RGDLQVLAQK antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

ID: 1482565

Description: epitope description:RDALPNTEASGPTHSKE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482572

Description: epitope description:RYNRNAVPNL antigen name:Polyprotein host organism:Cavia porcellus

Synthetic peptides from four separate regions of the poliovirus type 1 capsid protein VP1 induce neutralizing antibodies.

ID: 1482573

Description: epitope description:RDALPNTEASGPTHSKE antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White

Delineation of a neutralizing subregion within the immunodominant epitope (GH loop) of foot-and-mouth disease virus VP1 which does not contain the RGD...

ID: 1482577

Description: epitope description:DLQVLAQKVA antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley