Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

ID: 1473964

Description: epitope description:QLCQMLGKIIAQQNQSRGKGPGKKNKKK antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

Candidate peptide-vaccines induced immunity against CSFV and identified sequential neutralizing determinants in antigenic domain A of glycoprotein E2.

ID: 1473969

Description: epitope description:CPFDTSPVVKGKYNTTLLNGSAF antigen name:Genome polyprotein host organism:Sus scrofa

Candidate peptide-vaccines induced immunity against CSFV and identified sequential neutralizing determinants in antigenic domain A of glycoprotein E2.

ID: 1473971

Description: epitope description:PIGWTGVIECTAVS antigen name:Genome polyprotein host organism:Sus scrofa

Structure of IgE epitopes on a new 39-kD allergen molecule from the house dust mite, Dermatophagoides farinae.

ID: 1473984

Description: epitope description:FVMKREPLRFRDITVEGNENAYIKNGKLHLSLMDPSTLSLVTKADGKID antigen name:Other Dermatophagoides farinae (American house dust mite) protein h...

Structure of IgE epitopes on a new 39-kD allergen molecule from the house dust mite, Dermatophagoides farinae.

ID: 1473989

Description: epitope description:DVELSLRSSDIA antigen name:Other Dermatophagoides farinae (American house dust mite) protein host organism:Homo sapiens antibody na...