Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Virus neutralizing activity induced by synthetic peptides of glycoprotein D of herpes simplex virus type 1, selected by their reactivity with hyperimm...

    ID: 1378496

    Description: epitope description:PVGTVAPQIPPNWHIPSIQD antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus Groot Chinchilla antibody name:anti-...

    Publication: 2167930;

  2. Virus neutralizing activity induced by synthetic peptides of glycoprotein D of herpes simplex virus type 1, selected by their reactivity with hyperimm...

    ID: 1378498

    Description: epitope description:KMADPNRFRGKDLPV + NLeu(M2) antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus Groot Chinchilla antibody name...

    Publication: 2167930;

  3. Virus neutralizing activity induced by synthetic peptides of glycoprotein D of herpes simplex virus type 1, selected by their reactivity with hyperimm...

    ID: 1378500

    Description: epitope description:TPNATQPELAPEDPE antigen name:Envelope glycoprotein D host organism:Oryctolagus cuniculus Groot Chinchilla antibody name:anti-260-2...

    Publication: 2167930;

  4. Characterization of monoclonal antibody MEST-2 specific to glucosylceramide of fungi and plants.

    ID: 1378523

    Description: epitope description:(2R,3R,23Z,33Z)-3-hydroxy-2-octyldopentaconta-23,33-dienoic acid antigen name:glucosylceramide host organism:Mus musculus BALB/c a...

    Publication: 11287397;

  5. Characterization of monoclonal antibody MEST-2 specific to glucosylceramide of fungi and plants.

    ID: 1378529

    Description: epitope description:(2R,3R,23Z,33Z)-3-hydroxy-2-octyldopentaconta-23,33-dienoic acid antigen name:glucosylceramide host organism:Mus musculus BALB/c a...

    Publication: 11287397;

  6. Characterization of monoclonal antibody MEST-2 specific to glucosylceramide of fungi and plants.

    ID: 1378531

    Description: epitope description:(2R,3R,23Z,33Z)-3-hydroxy-2-octyldopentaconta-23,33-dienoic acid antigen name:glucosylceramide host organism:Mus musculus BALB/c a...

    Publication: 11287397;

  7. Herpes simplex virus type 1-specific immunity induced by peptides corresponding to an antigenic site of glycoprotein B.

    ID: 1378535

    Description: epitope description:TGDPKPKKNKKPKNPTPPRP antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:MAb B6

    Publication: 1698994;

  8. Herpes simplex virus type 1-specific immunity induced by peptides corresponding to an antigenic site of glycoprotein B.

    ID: 1378537

    Description: epitope description:TGDPKPKKNKKPKNPTPPRP antigen name:Envelope glycoprotein B host organism:Mus musculus C3H

    Publication: 1698994;

  9. Herpes simplex virus type 1-specific immunity induced by peptides corresponding to an antigenic site of glycoprotein B.

    ID: 1378539

    Description: epitope description:TGDPKPKKNKKPKNPTPPRP antigen name:Envelope glycoprotein B host organism:Mus musculus C3H

    Publication: 1698994;

  10. Herpes simplex virus type 1-specific immunity induced by peptides corresponding to an antigenic site of glycoprotein B.

    ID: 1378541

    Description: epitope description:AGHATLREHLRDIKAENTDA antigen name:Envelope glycoprotein B host organism:Mus musculus C3H

    Publication: 1698994;

  11. The porcine humoral immune response against pseudorabies virus specifically targets attachment sites on glycoprotein gC.

    ID: 1378546

    Description: epitope description:STPPVPPPSVSRRKP antigen name:envelope glycoprotein C host organism:Capra hircus

    Publication: 10644346;

  12. The porcine humoral immune response against pseudorabies virus specifically targets attachment sites on glycoprotein gC.

    ID: 1378548

    Description: epitope description:PRNNNRTRVHGDKAT antigen name:envelope glycoprotein C host organism:Sus scrofa NIH miniature pig

    Publication: 10644346;

  13. The porcine humoral immune response against pseudorabies virus specifically targets attachment sites on glycoprotein gC.

    ID: 1378550

    Description: epitope description:PRNNNRTRVHGDKAT antigen name:envelope glycoprotein C host organism:Capra hircus

    Publication: 10644346;

  14. The porcine humoral immune response against pseudorabies virus specifically targets attachment sites on glycoprotein gC.

    ID: 1378553

    Description: epitope description:RTRVHGDKATAHGRK antigen name:envelope glycoprotein C host organism:Capra hircus

    Publication: 10644346;

  15. The porcine humoral immune response against pseudorabies virus specifically targets attachment sites on glycoprotein gC.

    ID: 1378558

    Description: epitope description:STPPVPPPSVSRRKP antigen name:envelope glycoprotein C host organism:Mus musculus BALB/c

    Publication: 10644346;

  16. The porcine humoral immune response against pseudorabies virus specifically targets attachment sites on glycoprotein gC.

    ID: 1378560

    Description: epitope description:STPPVPPPSVSRRKP antigen name:envelope glycoprotein C host organism:Mus musculus BALB/c

    Publication: 10644346;

  17. Mapping T and B lymphocyte epitopes of bovine herpesvirus-1 glycoprotein B.

    ID: 1378583

    Description: epitope description:HTTDDVYTALGSAGLYRTGTS antigen name:envelope glycoprotein B host organism:Bos taurus Holstein antibody name:Bovine Serum

    Publication: 10573163;

  18. Mapping T and B lymphocyte epitopes of bovine herpesvirus-1 glycoprotein B.

    ID: 1378590

    Description: epitope description:TGRRLKEPVSRNFLRTQHVTV antigen name:envelope glycoprotein B host organism:Bos taurus Holstein antibody name:Bovine Serum

    Publication: 10573163;

  19. Mapping T and B lymphocyte epitopes of bovine herpesvirus-1 glycoprotein B.

    ID: 1378591

    Description: epitope description:FLRTQHVTVAWDWVPKRKNVC antigen name:envelope glycoprotein B host organism:Bos taurus Holstein antibody name:Bovine Serum

    Publication: 10573163;

  20. Mapping T and B lymphocyte epitopes of bovine herpesvirus-1 glycoprotein B.

    ID: 1378594

    Description: epitope description:SRGNFRFTARSLSATFVSDSH antigen name:envelope glycoprotein B host organism:Bos taurus Holstein antibody name:Bovine Serum

    Publication: 10573163;

  21. Mapping T and B lymphocyte epitopes of bovine herpesvirus-1 glycoprotein B.

    ID: 1378603

    Description: epitope description:PRRARRAAPSAPGGPGAANGP antigen name:envelope glycoprotein B host organism:Bos taurus Holstein antibody name:Bovine Serum

    Publication: 10573163;

  22. Mapping T and B lymphocyte epitopes of bovine herpesvirus-1 glycoprotein B.

    ID: 1378604

    Description: epitope description:GGPGAANGPAGDGDAGGRVTT antigen name:envelope glycoprotein B host organism:Bos taurus Holstein antibody name:Bovine Serum

    Publication: 10573163;

  23. Mapping T and B lymphocyte epitopes of bovine herpesvirus-1 glycoprotein B.

    ID: 1378605

    Description: epitope description:PARLSAPGVRGWHTTDDVYTA antigen name:envelope glycoprotein B host organism:Bos taurus antibody name:Bovine Serum

    Publication: 10573163;

  24. Mapping T and B lymphocyte epitopes of bovine herpesvirus-1 glycoprotein B.

    ID: 1378611

    Description: epitope description:YDSFALSTGDIIYMSPFYGLR antigen name:envelope glycoprotein B host organism:Bos taurus antibody name:Bovine Serum

    Publication: 10573163;

  25. Mapping of epitopes on the 65k DNA-binding protein of herpes simplex virus type 1.

    ID: 1378630

    Description: epitope description:ADPVPL antigen name:DNA polymerase processivity factor host organism:Oryctolagus cuniculus antibody name:13810

    Publication: 2476527;

  26. Mapping of epitopes on the 65k DNA-binding protein of herpes simplex virus type 1.

    ID: 1378633

    Description: epitope description:GPQTPY antigen name:DNA polymerase processivity factor host organism:Oryctolagus cuniculus antibody name:13810

    Publication: 2476527;

  27. Construction of polyepitope fusion antigens of human cytomegalovirus ppUL32: reactivity with human antibodies.

    ID: 1378680

    Description: epitope description:TPTPVNPSTAPAPAPTPTFA antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 7512094;

  28. Construction of polyepitope fusion antigens of human cytomegalovirus ppUL32: reactivity with human antibodies.

    ID: 1378681

    Description: epitope description:TPTPVNPSTAPAPAPTPTFA antigen name:Tegument protein pp150 host organism:Homo sapiens

    Publication: 7512094;

  29. Construction of polyepitope fusion antigens of human cytomegalovirus ppUL32: reactivity with human antibodies.

    ID: 1378683

    Description: epitope description:GGAKTPSDAVQNISQKIEKIKNTEE antigen name:Other Human betaherpesvirus 5 (Human cytomegalovirus) protein host organism:Homo sapiens

    Publication: 7512094;

  30. Antibodies in rheumatoid arthritis react specifically with the glycine alanine repeat sequence of Epstein-Barr nuclear antigen-1.

    ID: 1378738

    Description: epitope description:GAGGGAGGAGAGGGAGGAGA antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 2481875;

  31. Kinetic analysis of synthetic analogues of linear-epitope peptides of glycoprotein D of herpes simplex virus type 1 by surface plasmon resonance.

    ID: 1378750

    Description: epitope description:LKMADPNRFRG antigen name:Envelope glycoprotein D host organism:Mus musculus BALB/c antibody name:A16

    Publication: 8797855;

  32. Epitope mapping identifies an exposed loop between the unique amino- and conserved carboxy-domains of the large subunit of herpes simplex virus type 1...

    ID: 1378759

    Description: epitope description:TGTAYPVPLELTPENA antigen name:Ribonucleoside-diphosphate reductase large subunit host organism:Mus musculus antibody name:mAb 1026

    Publication: 7690841;

  33. Generation of anti-peptide and anti-protein sera. Effect of peptide presentation on immunogenicity.

    ID: 1378788

    Description: epitope description:GGFVQFVTSTRNA antigen name:Envelope protein UL45 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1707429;

  34. Generation of anti-peptide and anti-protein sera. Effect of peptide presentation on immunogenicity.

    ID: 1378791

    Description: epitope description:LYATFDEFPPP antigen name:Virion egress protein UL31 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1707429;

  35. Generation of anti-peptide and anti-protein sera. Effect of peptide presentation on immunogenicity.

    ID: 1378792

    Description: epitope description:THHLVKRRGLGA antigen name:Virion host shutoff protein host organism:Oryctolagus cuniculus Sandy Half-Lop

    Publication: 1707429;

  36. Generation of anti-peptide and anti-protein sera. Effect of peptide presentation on immunogenicity.

    ID: 1378793

    Description: epitope description:YRPLGPGTPPMRARLPA antigen name:Envelope protein UL45 host organism:Oryctolagus cuniculus Sandy Half-Lop

    Publication: 1707429;

  37. Generation of anti-peptide and anti-protein sera. Effect of peptide presentation on immunogenicity.

    ID: 1378795

    Description: epitope description:LTPANLIRGDNA antigen name:Tegument protein UL46 host organism:Oryctolagus cuniculus Sandy Half-Lop

    Publication: 1707429;

  38. Molecular mimicry and myasthenia gravis. An autoantigenic site of the acetylcholine receptor alpha-subunit that has biologic activity and reacts immun...

    ID: 1378801

    Description: epitope description:AINPESDQPDLSNF antigen name:Acetylcholine receptor subunit alpha (UniProt:P02708) host organism:Homo sapiens

    Publication: 2551924;

  39. Molecular mimicry and myasthenia gravis. An autoantigenic site of the acetylcholine receptor alpha-subunit that has biologic activity and reacts immun...

    ID: 1378803

    Description: epitope description:AINPESDQPDLSNF antigen name:Acetylcholine receptor subunit alpha (UniProt:P02708) host organism:Homo sapiens

    Publication: 2551924;

  40. Locations of herpes simplex virus type 2 glycoprotein B epitopes recognized by human serum immunoglobulin G antibodies.

    ID: 1378804

    Description: epitope description:SAAPAAPAAPRASGGVAATVAANGGPAS antigen name:Envelope glycoprotein B host organism:Homo sapiens

    Publication: 8627770;

  41. T cell responses to synthetic peptides of herpes simplex virus type 1 glycoprotein D in naturally infected individuals.

    ID: 1378839

    Description: epitope description:RFRGKDLPVLDQLTD antigen name:Envelope glycoprotein D host organism:Homo sapiens

    Publication: 8503783;

  42. T cell responses to synthetic peptides of herpes simplex virus type 1 glycoprotein D in naturally infected individuals.

    ID: 1378855

    Description: epitope description:TIAWFRMGGNCAIPI antigen name:Envelope glycoprotein D host organism:Homo sapiens

    Publication: 8503783;

  43. T cell responses to synthetic peptides of herpes simplex virus type 1 glycoprotein D in naturally infected individuals.

    ID: 1378888

    Description: epitope description:PELAPEDPEDSALLE antigen name:Envelope glycoprotein D host organism:Homo sapiens

    Publication: 8503783;

  44. Variability of the glycoprotein G gene in clinical isolates of herpes simplex virus type 1.

    ID: 1378995

    Description: epitope description:F111 antigen name:Envelope glycoprotein G host organism:Mus musculus antibody name:gG-1 mAb

    Publication: 10548571;

  45. Antibodies to an Epstein-Barr virus nuclear antigen synthetic peptide in infectious mononucleosis. Report of two cases.

    ID: 1379003

    Description: epitope description:AGAGGGAGGAGAGGGAGGAG antigen name:Epstein-Barr nuclear antigen 1 host organism:Homo sapiens

    Publication: 2552793;

  46. Epitope mapping of mouse monoclonal antibodies to the ppUL83 lower matrix phosphoprotein of human cytomegalovirus.

    ID: 1379010

    Description: epitope description:GRLKAESTV antigen name:65 kDa phosphoprotein host organism:Mus musculus BALB/c antibody name:Mab C5

    Publication: 10022802;

  47. Epitope mapping of mouse monoclonal antibodies to the ppUL83 lower matrix phosphoprotein of human cytomegalovirus.

    ID: 1379012

    Description: epitope description:VFPTKDVAL antigen name:65 kDa phosphoprotein host organism:Mus musculus BALB/c antibody name:MAb C6

    Publication: 10022802;

  48. Epitope mapping of mouse monoclonal antibodies to the ppUL83 lower matrix phosphoprotein of human cytomegalovirus.

    ID: 1379013

    Description: epitope description:DPVAALFFF antigen name:65 kDa phosphoprotein host organism:Mus musculus BALB/c antibody name:MAb C11

    Publication: 10022802;

  49. Epitope mapping of mouse monoclonal antibodies to the ppUL83 lower matrix phosphoprotein of human cytomegalovirus.

    ID: 1379014

    Description: epitope description:AALFFFDID antigen name:65 kDa phosphoprotein host organism:Mus musculus BALB/c antibody name:MAb C11

    Publication: 10022802;

  50. Epitope mapping of mouse monoclonal antibodies to the ppUL83 lower matrix phosphoprotein of human cytomegalovirus.

    ID: 1379021

    Description: epitope description:MTRGRLKAE antigen name:65 kDa phosphoprotein host organism:Mus musculus BALB/c antibody name:MAb C13 and C5

    Publication: 10022802;

  51. Development of recombinant diagnostic reagents based on pp85(U14) and p86(U11) proteins to detect the human immune response to human herpesvirus 7 inf...

    ID: 1379034

    Description: epitope description:SRPGSTTPSGNSARYGNNT antigen name:U14 protein host organism:Mus musculus BALB/c antibody name:MAb 5E1

    Publication: 10565918;

  52. Mapping of the epitopes of Epstein-Barr virus gp350 using monoclonal antibodies and recombinant proteins expressed in Escherichia coli defines three a...

    ID: 1379106

    Description: epitope description:PASQDMPTNTTDITYV antigen name:Envelope glycoprotein GP350 host organism:Mus musculus antibody name:BMA-17

    Publication: 1719128;

  53. Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

    ID: 1379120

    Description: epitope description:MTDSPGGVAP antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c antibody name:13

    Publication: 8578868;

  54. Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

    ID: 1379122

    Description: epitope description:GDRGILIHNTIFGEQVFLPLEHSQFSRYRWRGPTAAFLSLVDQKRSL antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c ...

    Publication: 8578868;

  55. Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

    ID: 1379124

    Description: epitope description:GDRGILIHNTIFGEQVFLPLEHSQFSRYRWRGPTAAFLSLVDQKRSL antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c ...

    Publication: 8578868;

  56. HSP 90, yeasts and Corynebacterium jeikeium.

    ID: 1379146

    Description: epitope description:STDEPAGESA antigen name:Heat shock protein 90 homolog host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1718769;

  57. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379176

    Description: epitope description:MSRTKETARAKRTITSKKSK antigen name:Putative histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;

  58. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379177

    Description: epitope description:KRTITSKKSKKAPSGASGVK antigen name:Histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;

  59. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379179

    Description: epitope description:RSHRRWRPGTCAIREIRKFQ antigen name:Histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;

  60. Characterization of the antigenic determinants of the Leishmania infantum histone H3 recognized by antibodies elicited during canine visceral leishman...

    ID: 1379186

    Description: epitope description:TNLACIHAKRVTIQPKDIQL antigen name:Histone H3 host organism:Canis lupus familiaris

    Publication: 8973612;

  61. Synthetic peptides to identify antigenic determinants on Epstein-Barr virus gp350/220.

    ID: 1379189

    Description: epitope description:TGEDPGFFNV antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1703134;

  62. Synthetic peptides to identify antigenic determinants on Epstein-Barr virus gp350/220.

    ID: 1379190

    Description: epitope description:TGEDPGFFNV antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1703134;

  63. Synthetic peptides to identify antigenic determinants on Epstein-Barr virus gp350/220.

    ID: 1379191

    Description: epitope description:STTPRPRYNA antigen name:Envelope glycoprotein GP350 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1703134;

  64. The influence of branched polypeptide carriers on the immunogenicity of predicted epitopes of HSV-1 glycoprotein D.

    ID: 1379204

    Description: epitope description:SALLEDPVG antigen name:Envelope glycoprotein D host organism:Mus musculus

    Publication: 7527933;

  65. Locations of herpes simplex virus type 2 glycoprotein B epitopes recognized by human serum immunoglobulin G antibodies.

    ID: 1379207

    Description: epitope description:SAAPAAPAAPRASGGVAATVAANG antigen name:Envelope glycoprotein B host organism:Homo sapiens

    Publication: 8627770;

  66. Mycobacterial 65,000 MW heat-shock protein shares a carboxy-terminal epitope with human epidermal cytokeratin 1/2.

    ID: 1379222

    Description: epitope description:EKASVPGGGDMGGMDF antigen name:60 kDa chaperonin 2 host organism:Mus musculus BALB/c antibody name:Ne5 and Nd4

    Publication: 1385316;

  67. Identification of a novel B-cell epitope of restricted specificity on the hsp 65-kDa protein of Mycobacterium tuberculosis.

    ID: 1379232

    Description: epitope description:EKASVPGGGDMGGMDF antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:Ne5 and Nd4

    Publication: 1711877;

  68. Identification of a novel B-cell epitope of restricted specificity on the hsp 65-kDa protein of Mycobacterium tuberculosis.

    ID: 1379234

    Description: epitope description:EKASVPGGGDMGGMDF antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:Ne5

    Publication: 1711877;

  69. Identification of a novel B-cell epitope of restricted specificity on the hsp 65-kDa protein of Mycobacterium tuberculosis.

    ID: 1379235

    Description: epitope description:EKASVPGGGDMGGMDF antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:Ne5

    Publication: 1711877;

  70. Identification of a novel B-cell epitope of restricted specificity on the hsp 65-kDa protein of Mycobacterium tuberculosis.

    ID: 1379237

    Description: epitope description:EKASVPGGGDMGGMDF antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Mus musculus BALB/c antibody name:Ne5

    Publication: 1711877;

  71. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379385

    Description: epitope description:GPSSFSSR antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  72. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379387

    Description: epitope description:AETLPIIT antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  73. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379388

    Description: epitope description:PIITSSES antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  74. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379392

    Description: epitope description:SIDKIGGG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  75. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379401

    Description: epitope description:CHNAETAG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  76. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379404

    Description: epitope description:GDVRGARL antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  77. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379407

    Description: epitope description:GIIPTNDV antigen name:Other Leishmania infantum protein host organism:Homo sapiens

    Publication: 9229379;

  78. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379412

    Description: epitope description:ASGSSEHM antigen name:Other Leishmania infantum protein host organism:Homo sapiens

    Publication: 9229379;

  79. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379415

    Description: epitope description:HLPRVPIG antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  80. Identification and characterization of human B-cell epitopes in recombinant antigens of Leishmania aethiopica.

    ID: 1379419

    Description: epitope description:ISPPLFSC antigen name:Leishmania aethiopica protein host organism:Homo sapiens

    Publication: 9229379;

  81. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380336

    Description: epitope description:QWFLDL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  82. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380346

    Description: epitope description:LPGADT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  83. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380351

    Description: epitope description:TQGSNW antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  84. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380354

    Description: epitope description:SNWIQK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  85. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380356

    Description: epitope description:WIQKET antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  86. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380362

    Description: epitope description:LVTFKN antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  87. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380363

    Description: epitope description:VTFKNP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  88. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380365

    Description: epitope description:FKNPHA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  89. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380366

    Description: epitope description:KNPHAK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  90. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380369

    Description: epitope description:HAKKQD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  91. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380374

    Description: epitope description:DVVVLG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  92. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380381

    Description: epitope description:QEGAMH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  93. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380384

    Description: epitope description:AMHTAL antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  94. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380388

    Description: epitope description:ALTGAT antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  95. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380401

    Description: epitope description:NLLFTG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  96. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380402

    Description: epitope description:LLFTGH antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  97. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380411

    Description: epitope description:RLRMDK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  98. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380413

    Description: epitope description:RMDKLQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  99. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380416

    Description: epitope description:KLQLKG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;

  100. Identification of continuous epitopes of the envelope glycoprotein of dengue type 2 virus.

    ID: 1380435

    Description: epitope description:EIAETQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 2472749;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston