Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "
  1. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464129

    Description: epitope description:AQYAAQNRRGLDLLFW antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;
  2. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464174

    Description: epitope description:NCKITKTPTAWKPNYAPANCPKS antigen name:UniProt:W5V4N0 host organism:Oryctolagus cuniculus antibody name:P288 (PAK) sera

    Publication: 15386623;
  3. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464207

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:P288 (PAK) s...

    Publication: 15386623;
  4. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464210

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) ...

    Publication: 15386623;
  5. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464216

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:L164 (PAO) s...

    Publication: 15386623;
  6. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464221

    Description: epitope description:KCTSDQDEQFIPKGCSK antigen name:Other Pseudomonas aeruginosa protein host organism:Oryctolagus cuniculus antibody name:P288 (PAK) s...

    Publication: 15386623;
  7. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464234

    Description: epitope description:ACKSTQDPMFTPKGCDN antigen name:Fimbrial protein host organism:Oryctolagus cuniculus antibody name:L164 (PAO) sera

    Publication: 15386623;
  8. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464244

    Description: epitope description:ACKSTQDPMFTPKGCDN antigen name:Fimbrial protein host organism:Oryctolagus cuniculus antibody name:L164 (PAO) sera

    Publication: 15386623;
  9. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464245

    Description: epitope description:ACKSTQDPMFTPKGCDN antigen name:Fimbrial protein host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P se...

    Publication: 15386623;
  10. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464246

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:P288 (PAK) sera

    Publication: 15386623;
  11. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464251

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;
  12. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464253

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:P288 (PAK) sera

    Publication: 15386623;
  13. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464256

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;
  14. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464257

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;
  15. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464260

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:P288 (PAK) sera

    Publication: 15386623;
  16. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464262

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;
  17. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464263

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;
  18. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464265

    Description: epitope description:KCKSDQDPQFIPKGCSK host organism:Oryctolagus cuniculus antibody name:L169 (PAK*) (anti-T130K/E135P sera)

    Publication: 15386623;
  19. Synthetic peptide vaccine development: measurement of polyclonal antibody affinity and cross-reactivity using a new peptide capture and release system...

    ID: 1464267

    Description: epitope description:SCATTVDAKFRPNGCTD antigen name:UniProt:W5V4N0 host organism:Oryctolagus cuniculus antibody name:P286 (PAK) sera

    Publication: 15386623;
  20. Expression of HTLV-I Env and Tax recombinant peptides in yeast: identification of immunogenic domains.

    ID: 1464523

    Description: epitope description:SVPSSSSTPLLYPSLALPAPHLTLPFNWT antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 7679862;
  21. Development of a multi-mimotope peptide as a vaccine immunogen for infectious bursal disease virus.

    ID: 1464530

    Description: epitope description:HPDSIHPFLASP host organism:Mus musculus BALB/c antibody name:2B1

    Publication: 17445956;
  22. Vaccination against lethal coronavirus-induced encephalitis with a synthetic decapeptide homologous to a domain in the predicted peplomer stalk.

    ID: 1464552

    Description: epitope description:CVKSQTTRIN antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 2455823;
  23. Development of a multi-mimotope peptide as a vaccine immunogen for infectious bursal disease virus.

    ID: 1464569

    Description: epitope description:RTNHSGNSVPDK host organism:Mus musculus BALB/c antibody name:F1

    Publication: 17445956;
  24. Development of a multi-mimotope peptide as a vaccine immunogen for infectious bursal disease virus.

    ID: 1464574

    Description: epitope description:QKLPYGPRFWLG host organism:Mus musculus BALB/c antibody name:F7

    Publication: 17445956;
  25. Development of a multi-mimotope peptide as a vaccine immunogen for infectious bursal disease virus.

    ID: 1464580

    Description: epitope description:HTADKYVSELMG host organism:Mus musculus BALB/c antibody name:B34

    Publication: 17445956;
  26. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464591

    Description: epitope description:VHDSDLEHVLTPSTSWTTKILKF antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;
  27. Identification of immunodominant epitopes in envelope glycoprotein of human T lymphotropic virus type II.

    ID: 1464593

    Description: epitope description:WHVLYTPNISIPQQTSSRTILFP antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens

    Publication: 1727602;
  28. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473902

    Description: epitope description:LGKIIAQQNQSRGKGPGKKSKKKSPEKP antigen name:Nucleoprotein host organism:Mus musculus antibody name:5H2

    Publication: 16426684;
  29. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473905

    Description: epitope description:VNQLCQLLGAMIKSQRQQPGGQAKKKK antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;
  30. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473906

    Description: epitope description:KKNKKKNPEKPHFPLATEDDVRHHFTPS antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6

    Publication: 16426684;
  31. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473907

    Description: epitope description:GQAKKKKPEKPHFPLAAEDDIRHHLTQT antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;
  32. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473908

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;
  33. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473912

    Description: epitope description:LGKIIAQQNQSRGKGPGKKIKNKNPEKP antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6 and 2G7

    Publication: 16426684;
  34. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473916

    Description: epitope description:EFSLPTHHTVRLIRVTASPSA antigen name:Nucleoprotein host organism:Mus musculus antibody name:2D6

    Publication: 16426684;
  35. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473961

    Description: epitope description:QLCQMLGKIIAQQNQSRGKGPGKKNKKK antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;
  36. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1473964

    Description: epitope description:QLCQMLGKIIAQQNQSRGKGPGKKNKKK antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;
  37. Candidate peptide-vaccines induced immunity against CSFV and identified sequential neutralizing determinants in antigenic domain A of glycoprotein E2.

    ID: 1473969

    Description: epitope description:CPFDTSPVVKGKYNTTLLNGSAF antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 16300867;
  38. Candidate peptide-vaccines induced immunity against CSFV and identified sequential neutralizing determinants in antigenic domain A of glycoprotein E2.

    ID: 1473971

    Description: epitope description:PIGWTGVIECTAVS antigen name:Genome polyprotein host organism:Sus scrofa

    Publication: 16300867;
  39. Structure of IgE epitopes on a new 39-kD allergen molecule from the house dust mite, Dermatophagoides farinae.

    ID: 1473984

    Description: epitope description:FVMKREPLRFRDITVEGNENAYIKNGKLHLSLMDPSTLSLVTKADGKID antigen name:Other Dermatophagoides farinae (American house dust mite) protein h...

    Publication: 7510559;
  40. Structure of IgE epitopes on a new 39-kD allergen molecule from the house dust mite, Dermatophagoides farinae.

    ID: 1473989

    Description: epitope description:DVELSLRSSDIA antigen name:Other Dermatophagoides farinae (American house dust mite) protein host organism:Homo sapiens antibody na...

    Publication: 7510559;
  41. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474000

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;
  42. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474003

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;
  43. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474004

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;
  44. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474013

    Description: epitope description:GKKNKKKNP antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;
  45. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474014

    Description: epitope description:GKKNKKKNP antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;
  46. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474017

    Description: epitope description:KNPEKPHFPL antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;
  47. Identification of immunodominant VP1 linear epitope of enterovirus 71 (EV71) using synthetic peptides for detecting human anti-EV71 IgG antibodies in ...

    ID: 1474025

    Description: epitope description:LEGTTNPNG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 18076666;
  48. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474037

    Description: epitope description:IAQQNQSRGKGPGKKNKKKNPEKPHFPL antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;
  49. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474044

    Description: epitope description:QLCQMLGKIIAQQNQSRGKGPGKKNKKK antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;
  50. Peptide ELISA for measuring antibodies to N-protein of porcine reproductive and respiratory syndrome virus.

    ID: 1474045

    Description: epitope description:VNQLCQLLGAMIKSQRQQPGGQAKKKK antigen name:Nucleoprotein host organism:Sus scrofa antibody name:Pig sera

    Publication: 16426684;

Displaying 50 of 1,510,353 results for " "