Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 5 of 1,510,353 results for " "
  1. Effective synthetic peptide vaccine for foot-and-mouth disease in swine.

    ID: 1474308

    Description: epitope description:NKYSASGSGVRGDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:Gui...

    Publication: 12057619;
  2. Epitope mapping of region 11-70 of ovalbumin (Gal d I) using five synthetic peptides.

    ID: 1474321

    Description: epitope description:CFDVFKELK antigen name:Gal d 2 host organism:Homo sapiens

    Publication: 7950407;
  3. Variable linking region immunogenicity using malarial peptide carrier protein conjugates of defined composition.

    ID: 1474324

    Description: epitope description:SKYSNTFI antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 2086458;
  4. Variable linking region immunogenicity using malarial peptide carrier protein conjugates of defined composition.

    ID: 1474326

    Description: epitope description:YSNTFINN antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 2086458;
  5. Variable linking region immunogenicity using malarial peptide carrier protein conjugates of defined composition.

    ID: 1474329

    Description: epitope description:TFINNAYN antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus BALB/c

    Publication: 2086458;

Displaying 5 of 1,510,353 results for " "