Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Immunohistochemical detection of Influenza virus infection in formalin-fixed tissues with anti-H5 monoclonal antibody recognizing FFWTILKP.

    ID: 1598434

    Description: epitope description:FFWTILKP antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:7H10

    Publication: 18930768;

  2. Matrix protein 2 vaccination and protection against influenza viruses, including subtype H5N1.

    ID: 1598497

    Description: epitope description:MSLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus Nude

    Publication: 17552096;

  3. Immunohistochemical detection of Influenza virus infection in formalin-fixed tissues with anti-H5 monoclonal antibody recognizing FFWTILKP.

    ID: 1598503

    Description: epitope description:FFWTILKP antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:7H10

    Publication: 18930768;

  4. Immunohistochemical detection of Influenza virus infection in formalin-fixed tissues with anti-H5 monoclonal antibody recognizing FFWTILKP.

    ID: 1598504

    Description: epitope description:FFWTILKP antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:7H10

    Publication: 18930768;

  5. Universal antibodies and their applications to the quantitative determination of virtually all subtypes of the influenza A viral hemagglutinins.

    ID: 1598509

    Description: epitope description:GLFGAIAGFIEGGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19007587;

  6. Antigenic structure of the hemagglutinin of H9N2 influenza viruses.

    ID: 1598514

    Description: epitope description:G90 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:L6/2

    Publication: 18989614;

  7. Matrix protein 2 vaccination and protection against influenza viruses, including subtype H5N1.

    ID: 1598516

    Description: epitope description:MSLLTEVETPTKNEWECRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus Nude

    Publication: 17552096;

  8. Universal antibodies and their applications to the quantitative determination of virtually all subtypes of the influenza A viral hemagglutinins.

    ID: 1598536

    Description: epitope description:GIFGAIAGFIEGGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19007587;

  9. Antigenic structure of the hemagglutinin of H9N2 influenza viruses.

    ID: 1598540

    Description: epitope description:T200, N201 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:E2/3, L7/7

    Publication: 18989614;

  10. Matrix protein 2 vaccination and protection against influenza viruses, including subtype H5N1.

    ID: 1598544

    Description: epitope description:MSLLTEVETPTKNEWECRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus Nude

    Publication: 17552096;

  11. Universal antibodies and their applications to the quantitative determination of virtually all subtypes of the influenza A viral hemagglutinins.

    ID: 1598547

    Description: epitope description:GIFGAIAGFIENGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19007587;

  12. Universal antibodies and their applications to the quantitative determination of virtually all subtypes of the influenza A viral hemagglutinins.

    ID: 1598554

    Description: epitope description:GLFGAIAGFIEGGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19007587;

  13. Universal antibodies and their applications to the quantitative determination of virtually all subtypes of the influenza A viral hemagglutinins.

    ID: 1598557

    Description: epitope description:GLFGAIAGFIEGGW antigen name:Hemagglutinin host organism:Oryctolagus cuniculus New Zealand White

    Publication: 19007587;

  14. Antigenic structure of the hemagglutinin of H9N2 influenza viruses.

    ID: 1598567

    Description: epitope description:S109, K113, N165 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:D272/6

    Publication: 18989614;

  15. Matrix protein 2 vaccination and protection against influenza viruses, including subtype H5N1.

    ID: 1598569

    Description: epitope description:MSLLTEVETPTKNEWECRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus Nude

    Publication: 17552096;

  16. Matrix protein 2 vaccination and protection against influenza viruses, including subtype H5N1.

    ID: 1598570

    Description: epitope description:MSLLTEVETPTRNEWECRCSDSSD antigen name:Matrix protein 2 host organism:Mus musculus Nude

    Publication: 17552096;

  17. Antigenic structure of the hemagglutinin of H9N2 influenza viruses.

    ID: 1598577

    Description: epitope description:L80 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:D370/4

    Publication: 18989614;

  18. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598592

    Description: epitope description:Q131, I132, I133, P134, E142, A143, S144, L145 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:FLA5.10

    Publication: 19381279;

  19. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598594

    Description: epitope description:S137, W138, S139, Y180, N181, N182, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:FLD21.140

    Publication: 19381279;

  20. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598598

    Description: epitope description:S137, W138, S139, Y180, N181, N182, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:FLD21.140

    Publication: 19381279;

  21. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598863

    Description: epitope description:S137, W138, S139, Y180, N181, N182, T183 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:FLD21.140

    Publication: 19381279;

  22. Cross-protective potential of a novel monoclonal antibody directed against antigenic site B of the hemagglutinin of influenza A viruses.

    ID: 1598879

    Description: epitope description:K172, G174, S209 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:S139/1

    Publication: 19300497;

  23. Cross-protective potential of a novel monoclonal antibody directed against antigenic site B of the hemagglutinin of influenza A viruses.

    ID: 1598890

    Description: epitope description:K172, G174, S209 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:S139/1

    Publication: 19300497;

  24. Cross-protective potential of a novel monoclonal antibody directed against antigenic site B of the hemagglutinin of influenza A viruses.

    ID: 1598893

    Description: epitope description:K172, G174, S209 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:S139/1

    Publication: 19300497;

  25. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598917

    Description: epitope description:QKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNK antigen name:Hemagglutinin host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  26. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598924

    Description: epitope description:VNSDTVGWSWPDGAELPFTID antigen name:Neuraminidase host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  27. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598947

    Description: epitope description:LMDHYLRIMSPVGTHKQIVYWKQWLSLKNPTQG antigen name:Protein PB1-F2 host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  28. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598970

    Description: epitope description:HPNSSAGLRDNLLENLQAYQKRMGVQMQRF antigen name:Matrix protein 1 host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  29. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598973

    Description: epitope description:ADQELGDAPFLDRLRRDQKS antigen name:Non-structural protein 1 host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  30. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598977

    Description: epitope description:EKANPVNDLCYPGDFNDYEELKH antigen name:Hemagglutinin host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  31. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598989

    Description: epitope description:QKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNK antigen name:Hemagglutinin host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  32. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598990

    Description: epitope description:DYPQYSEEARLKREEISGVKLESIGIYQI antigen name:Hemagglutinin host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  33. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598992

    Description: epitope description:DNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKH antigen name:Neuraminidase host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  34. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1598994

    Description: epitope description:HKIFKMEKGKVVKSVELDAPNYHY antigen name:Neuraminidase host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  35. Antigenic fingerprinting of H5N1 avian influenza using convalescent sera and monoclonal antibodies reveals potential vaccine and diagnostic targets.

    ID: 1599004

    Description: epitope description:MASQGTKRSYEQMETGGERQNATE antigen name:Nucleoprotein host organism:Homo sapiens antibody name:Human sera

    Publication: 19381279;

  36. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602865

    Description: epitope description:YCSTWDANKP antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  37. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602873

    Description: epitope description:KPYSWRSKYG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  38. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602874

    Description: epitope description:PYSWRSKYGW antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  39. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602879

    Description: epitope description:SKYGWTAFCG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  40. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602880

    Description: epitope description:KYGWTAFCGP antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  41. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602887

    Description: epitope description:CGPVGAHGQS antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  42. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603189

    Description: epitope description:GERTRGRQPGDYDDD antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  43. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603192

    Description: epitope description:GRWGPAGPREREREE antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  44. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603198

    Description: epitope description:PGSHVREETSRNNPF antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  45. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603201

    Description: epitope description:RYGNQNGRIRVLQRF antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  46. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603203

    Description: epitope description:QRSRQFQNLQNHRIV antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  47. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603205

    Description: epitope description:IEAKPNTLVLPKHAD antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  48. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603212

    Description: epitope description:YILNRHDNQNLRVAK antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  49. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603215

    Description: epitope description:QFEDFFPASSRDQSS antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  50. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603220

    Description: epitope description:LEENAGGEQEERGQR antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  51. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603223

    Description: epitope description:NEGVIVKVSKEHVEE antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  52. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603232

    Description: epitope description:LTCVEIKEGALMLPH antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  53. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603233

    Description: epitope description:GALMLPHFNSKAMVI antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  54. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603239

    Description: epitope description:EEEGSNREVRRYTAR antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  55. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603240

    Description: epitope description:VRRYTARLKEGDVFI antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  56. Analysis of the molecular mimicry between HLA-B27 and a bacterial OmpA protein using synthetic peptides.

    ID: 1603263

    Description: epitope description:LGYTDRIG antigen name:Outer membrane protein A host organism:Mus musculus BALB/c antibody name:Ye-2

    Publication: 1893633;

  57. Localization of the antigenic sites of newcastle disease virus nucleocapsid using a panel of monoclonal antibodies.

    ID: 1603270

    Description: epitope description:GDGETQFLDLMRAVANSMREAPNSAQSTTHPEPPPTPGPSQDNDTDWGY antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:a2s, ...

    Publication: 18599098;

  58. Localization of the antigenic sites of newcastle disease virus nucleocapsid using a panel of monoclonal antibodies.

    ID: 1603274

    Description: epitope description:GDGETQFLDLMRAVANSMREAPNSAQSTTHPEPPPTPGPSQDNDTDWGY antigen name:Nucleoprotein host organism:Mus musculus BALB/c antibody name:a2s, ...

    Publication: 18599098;

  59. Fine mapping of antigenic epitopes on capsid proteins of porcine circovirus, and antigenic phenotype of porcine circovirus type 2.

    ID: 1603290

    Description: epitope description:YHSRYFT antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:4H7

    Publication: 19059648;

  60. Fine mapping of antigenic epitopes on capsid proteins of porcine circovirus, and antigenic phenotype of porcine circovirus type 2.

    ID: 1603309

    Description: epitope description:LNP antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:8A12, 1C7

    Publication: 19059648;

  61. Fine mapping of antigenic epitopes on capsid proteins of porcine circovirus, and antigenic phenotype of porcine circovirus type 2.

    ID: 1603315

    Description: epitope description:YHSRYFT antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:4H7

    Publication: 19059648;

  62. Analysis of the molecular mimicry between HLA-B27 and a bacterial OmpA protein using synthetic peptides.

    ID: 1603320

    Description: epitope description:REDLR antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus BALB/c antibody name:Ye-2

    Publication: 1893633;

  63. Identification of serologically silent occult hepatitis C virus infection by detecting immunoglobulin G antibody to a dominant HCV core peptide epitop...

    ID: 1603350

    Description: epitope description:PKPQRKTKRNTNRRP antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 19070391;

  64. Characterization of dengue complex-reactive epitopes on dengue 3 virus envelope protein domain III.

    ID: 1603360

    Description: epitope description:V305, L306, K308, E309,V310, K325, A329, G381, I387, W389 antigen name:Genome polyprotein host organism:Mus musculus antibody name...

    Publication: 19101005;

  65. Characterization of dengue complex-reactive epitopes on dengue 3 virus envelope protein domain III.

    ID: 1603361

    Description: epitope description:L306, K308, E309,V310, G381, A384, I387, W389, R391 antigen name:Genome polyprotein host organism:Mus musculus antibody name:MA1-2...

    Publication: 19101005;

  66. Characterization of dengue complex-reactive epitopes on dengue 3 virus envelope protein domain III.

    ID: 1603363

    Description: epitope description:V305, L306, K308, E309, K325, G381, A384, I387, W389, R391 antigen name:Genome polyprotein host organism:Mus musculus antibody nam...

    Publication: 19101005;

  67. Characterization of dengue complex-reactive epitopes on dengue 3 virus envelope protein domain III.

    ID: 1603364

    Description: epitope description:V305, L306, K308, E309,V310, K325, A329, G381, I387, W389 antigen name:Genome polyprotein host organism:Mus musculus antibody name...

    Publication: 19101005;

  68. Characterization of dengue complex-reactive epitopes on dengue 3 virus envelope protein domain III.

    ID: 1603366

    Description: epitope description:L306, K308, V310, K325, A329, G381, A384, K386, I387, W389, R391 antigen name:Genome polyprotein host organism:Mus musculus antibo...

    Publication: 19101005;

  69. Characterization of dengue complex-reactive epitopes on dengue 3 virus envelope protein domain III.

    ID: 1603368

    Description: epitope description:V305, L306, K308, E309,V310, K325, A329, G381, I387, W389 antigen name:Genome polyprotein host organism:Mus musculus antibody name...

    Publication: 19101005;

  70. Characterization of dengue complex-reactive epitopes on dengue 3 virus envelope protein domain III.

    ID: 1603370

    Description: epitope description:L306, K308, V310, K325, A329, G381, A384, K386, I387, W389, R391 antigen name:Genome polyprotein host organism:Mus musculus antibo...

    Publication: 19101005;

  71. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602889

    Description: epitope description:PVGAHGQSSC antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  72. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602892

    Description: epitope description:AHGQSSCGKC antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  73. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602896

    Description: epitope description:SSCGKCLSVT antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  74. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602907

    Description: epitope description:TGTGAKTTVR antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  75. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602913

    Description: epitope description:TTVRIVDQCS antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  76. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602914

    Description: epitope description:TVRIVDQCSN antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  77. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602915

    Description: epitope description:VRIVDQCSNG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  78. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602929

    Description: epitope description:DVNVFRQLDT antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  79. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602939

    Description: epitope description:DGKGYERGHI antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  80. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602947

    Description: epitope description:HITVNYQFVD antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  81. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602949

    Description: epitope description:TVNYQFVDCG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  82. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602954

    Description: epitope description:FVDCGDSFNP antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  83. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602960

    Description: epitope description:SFNPLFSVMK antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  84. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602963

    Description: epitope description:PLFSVMKSSV antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  85. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602965

    Description: epitope description:FSVMKSSVIN antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  86. A synthetic peptide encompassing the G5 antigenic region of the rabies virus induces high avidity but poorly neutralizing antibody in immunized animal...

    ID: 1603124

    Description: epitope description:PPDQLVNLHDFRSDEIEHLVVEE antigen name:Glycoprotein host organism:Capra hircus Saanen

    Publication: 18955098;

  87. A major part of the polypeptide chain of tobacco mosaic virus protein is antigenic.

    ID: 1603145

    Description: epitope description:RGTGSYNRSSFES antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:57P, 174P

    Publication: 16453613;

  88. A major part of the polypeptide chain of tobacco mosaic virus protein is antigenic.

    ID: 1603147

    Description: epitope description:RNRIIEVENQANPTTAETLDATRRVDDA antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:161P

    Publication: 16453613;

  89. A major part of the polypeptide chain of tobacco mosaic virus protein is antigenic.

    ID: 1603153

    Description: epitope description:GLVWTSGPAT antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:28V

    Publication: 16453613;

  90. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603156

    Description: epitope description:QEPDDLKQKA antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  91. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603157

    Description: epitope description:LEYDPRCVYD antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  92. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603161

    Description: epitope description:REREEDWRQP antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  93. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603162

    Description: epitope description:EDWRRPSHQQ antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  94. Mapping and mutational analysis of the IgE-binding epitopes on Ara h 1, a legume vicilin protein and a major allergen in peanut hypersensitivity.

    ID: 1603180

    Description: epitope description:LASVSATHAKSSPYQ antigen name:Ara h 1 host organism:Homo sapiens

    Publication: 9151961;

  95. PrP antibody binding-induced epitope modulation evokes immunocooperativity.

    ID: 1603440

    Description: epitope description:HDCVNITIKQHTVTTTTKGENFTETDIKIMERVVEQMCTTQYQKES antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus...

    Publication: 18977037;

  96. PrP antibody binding-induced epitope modulation evokes immunocooperativity.

    ID: 1603441

    Description: epitope description:HDCVNITIKQHTVTTTTKGENFTETDIKIMERVVEQMCTTQYQKES antigen name:Mesocricetus auratus (Syrian golden hamster) protein host organism:Mus...

    Publication: 18977037;

  97. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1603535

    Description: epitope description:EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  98. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1603575

    Description: epitope description:LDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGDSFNPLFSVMKSSVIN antigen name:Hev b 6 host organism:Oryctolagus cuniculus antibody name:anti-MNA

    Publication: 9548517;

  99. Antigenicity and immunogenicity of a synthetic peptide derived from a glucan-binding domain of mutans streptococcal glucosyltransferase.

    ID: 1603578

    Description: epitope description:TGAQTIKGQKLYFKANGQQVKG antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus Sprague-Dawley

    Publication: 8514393;

  100. Antigenicity and immunogenicity of a synthetic peptide derived from a glucan-binding domain of mutans streptococcal glucosyltransferase.

    ID: 1603589

    Description: epitope description:TGAQTIKGQKLYFKANGQQVKG antigen name:KxYKxGKxW signal domain protein host organism:Rattus norvegicus Sprague-Dawley

    Publication: 8514393;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston