Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Antigenicity and immunogenicity of a synthetic peptide derived from a glucan-binding domain of mutans streptococcal glucosyltransferase.

    ID: 1603599

    Description: epitope description:TGAQTIKGQKLYFKANGQQVKG antigen name:KxYKxGKxW signal domain protein host organism:Homo sapiens

    Publication: 8514393;

  2. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603655

    Description: epitope description:VKDGYIVD antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  3. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603659

    Description: epitope description:VKDGYIVD antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  4. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603667

    Description: epitope description:IVDDVNC antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  5. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603669

    Description: epitope description:DDVNCTY antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  6. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603670

    Description: epitope description:DVNCTYF antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  7. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603674

    Description: epitope description:TYFCGRN antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  8. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603675

    Description: epitope description:YFCGRNA antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  9. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603684

    Description: epitope description:NEECTKL antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  10. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603685

    Description: epitope description:EECTKLK antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  11. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603688

    Description: epitope description:TKLKGES antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  12. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603689

    Description: epitope description:KLKGESG antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  13. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603702

    Description: epitope description:PYGNACY antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  14. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603704

    Description: epitope description:GNACYCY antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  15. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603706

    Description: epitope description:ACYCYKL antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  16. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603707

    Description: epitope description:CYCYKLP antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  17. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603708

    Description: epitope description:YCYKLPD antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  18. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603713

    Description: epitope description:PDHVRTK antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  19. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603714

    Description: epitope description:DHVRTKG antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  20. A conserved sequence region of scorpion toxins rendered immunogenic induces broadly cross-reactive, neutralizing antibodies.

    ID: 1603716

    Description: epitope description:VRTKGPG antigen name:Alpha-mammal toxin AaH2 host organism:Oryctolagus cuniculus

    Publication: 9022703;

  21. Recombinant peptide replicates immunogenicity of synthetic linear peptide chimera for use as pre-erythrocytic stage malaria vaccine.

    ID: 1603931

    Description: epitope description:KQISSQLTEEWSQGPGAPQGPGAPQGPGAPSYVPSAEQI host organism:Mus musculus BALB/c

    Publication: 19015042;

  22. Screening and identification of a novel B-cell neutralizing epitope from Helicobacter pylori UreB.

    ID: 1601428

    Description: epitope description:IEAGAIGFKIHEDWG antigen name:Urease subunit beta host organism:Mus musculus antibody name:Mab 6E6

    Publication: 18948159;

  23. Screening and identification of a novel B-cell neutralizing epitope from Helicobacter pylori UreB.

    ID: 1601429

    Description: epitope description:IEAGAIGFKIHEDWG antigen name:Urease subunit beta host organism:Mus musculus antibody name:Mab 6E6

    Publication: 18948159;

  24. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601430

    Description: epitope description:VKTKNTTTTQTQ antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  25. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601431

    Description: epitope description:KTKNTTTTQTQP antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  26. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601441

    Description: epitope description:QPSKPTTKQRQN antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  27. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601446

    Description: epitope description:TTKQRQNKPPNK antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  28. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601450

    Description: epitope description:RQNKPPNKPNND antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  29. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601451

    Description: epitope description:QNKPPNKPNNDF antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  30. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601452

    Description: epitope description:NKPPNKPNNDFH antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  31. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601455

    Description: epitope description:PNKPNNDFHFEV antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  32. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601458

    Description: epitope description:PNNDFHFEVFNF antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  33. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601468

    Description: epitope description:NFVPCSICSNNP antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  34. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601469

    Description: epitope description:FVPCSICSNNPT antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  35. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601472

    Description: epitope description:CSICSNNPTCWA antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  36. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601474

    Description: epitope description:ICSNNPTCWAIC antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  37. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601477

    Description: epitope description:NNPTCWAICKRI antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  38. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601480

    Description: epitope description:TCWAICKRIPNK antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  39. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601485

    Description: epitope description:CKRIPNKKPGKK antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  40. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601492

    Description: epitope description:KPGKKTTTKPTK antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  41. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601494

    Description: epitope description:GKKTTTKPTKKP antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  42. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601498

    Description: epitope description:TTKPTKKPTFKT antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  43. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601501

    Description: epitope description:PTKKPTFKTTKK antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  44. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601510

    Description: epitope description:TKKDHKPQTTKP antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  45. Passive transfer of serum antibodies induced by BBG2Na, a subunit vaccine, in the elderly protects SCID mouse lungs against respiratory syncytial viru...

    ID: 1601518

    Description: epitope description:TTKPKEVPTTKP antigen name:Major surface glycoprotein G host organism:Homo sapiens

    Publication: 12482664;

  46. Demonstration of cross-reactivity between bacterial antigens and class I human leukocyte antigens by using monoclonal antibodies to Shigella flexneri.

    ID: 1601561

    Description: epitope description:ETQICKAKAQTDREDLRTLLR antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus BALB/c anti...

    Publication: 2187807;

  47. Demonstration of cross-reactivity between bacterial antigens and class I human leukocyte antigens by using monoclonal antibodies to Shigella flexneri.

    ID: 1601566

    Description: epitope description:ETQICKAKAQTDREDLRTLLR antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus BALB/c anti...

    Publication: 2187807;

  48. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601575

    Description: epitope description:LTAYQTELAR antigen name:UniProt:I6TX52 host organism:Mus musculus B10.BR

    Publication: 7681043;

  49. Screening and identification of a novel B-cell neutralizing epitope from Helicobacter pylori UreB.

    ID: 1601586

    Description: epitope description:IEAGAIGFKIHEDWG antigen name:Urease subunit beta host organism:Mus musculus antibody name:Mab 6E6

    Publication: 18948159;

  50. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601615

    Description: epitope description:NAANEADYQA antigen name:UniProt:I6TX52 host organism:Mus musculus C57BL/10

    Publication: 7681043;

  51. Monoclonal antibodies against an HLA-B27-derived peptide react with an epitope present on bacterial proteins.

    ID: 1601616

    Description: epitope description:ETQICKAKAQTDREDLRTLLR antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus BALB/c anti...

    Publication: 1698856;

  52. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601619

    Description: epitope description:AANEADYQAK antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  53. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601621

    Description: epitope description:NEADYQAKLT antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  54. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601635

    Description: epitope description:QKANADAKAT antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  55. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601636

    Description: epitope description:ANADAKATYE antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  56. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601637

    Description: epitope description:NADAKATYEA antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  57. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601642

    Description: epitope description:AVAANNAKNA antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  58. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601644

    Description: epitope description:AANNAKNAAL antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  59. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601649

    Description: epitope description:KNAALTAENT antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  60. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601654

    Description: epitope description:TAENTAIKQR antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  61. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601665

    Description: epitope description:ATYEAALKQY antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  62. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601666

    Description: epitope description:EAALKQYEAD antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  63. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601669

    Description: epitope description:LKQYEADLAA antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  64. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601674

    Description: epitope description:AELKRVQEAN antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  65. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601680

    Description: epitope description:EANAANEADY antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  66. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601687

    Description: epitope description:KATYEAAVAA antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  67. Identification of antigenic epitopes in an alanine-rich repeating region of a surface protein antigen of Streptococcus mutants.

    ID: 1601689

    Description: epitope description:YEAALKQYEA antigen name:UniProt:I6TX52 host organism:Mus musculus BALB/c

    Publication: 7681043;

  68. Isothermal titration calorimetry reveals differential binding thermodynamics of variable region-identical antibodies differing in constant region for ...

    ID: 1601691

    Description: epitope description:SPNQHTPPWMLK host organism:Mus musculus BALB/c antibody name:3E5

    Publication: 18806257;

  69. Isothermal titration calorimetry reveals differential binding thermodynamics of variable region-identical antibodies differing in constant region for ...

    ID: 1601692

    Description: epitope description:SPNQHTPPWMLK host organism:Mus musculus BALB/c antibody name:3E5

    Publication: 18806257;

  70. Monoclonal antibodies against an HLA-B27-derived peptide react with an epitope present on bacterial proteins.

    ID: 1601755

    Description: epitope description:DREDLRTLLR antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus BALB/c antibody name:A...

    Publication: 1698856;

  71. Peptide-based antibody detection for tuberculosis diagnosis.

    ID: 1601829

    Description: epitope description:VANNTRLWVYCGNGTPNELG antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Homo sapiens

    Publication: 19005024;

  72. Peptide-based antibody detection for tuberculosis diagnosis.

    ID: 1601830

    Description: epitope description:MLVQHLLDRDLRVEIPGVDT antigen name:Ferritin BfrB host organism:Homo sapiens

    Publication: 19005024;

  73. Peptide-based antibody detection for tuberculosis diagnosis.

    ID: 1601835

    Description: epitope description:DFWATWCGPCKMVAPVLEEI antigen name:Thioredoxin (UniProt:P9WG67) host organism:Homo sapiens

    Publication: 19005024;

  74. Peptide-based antibody detection for tuberculosis diagnosis.

    ID: 1601841

    Description: epitope description:GEQFMQWFLQEQIEEVALMA antigen name:Ferritin BfrB host organism:Homo sapiens

    Publication: 19005024;

  75. Peptide-based antibody detection for tuberculosis diagnosis.

    ID: 1602076

    Description: epitope description:SAMILAAYHPQQFIYAGSLS antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Homo sapiens

    Publication: 19005024;

  76. Peptide-based antibody detection for tuberculosis diagnosis.

    ID: 1602085

    Description: epitope description:NDPTQQIPKLVANNTRLWVY antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Homo sapiens

    Publication: 19005024;

  77. Peptide-based antibody detection for tuberculosis diagnosis.

    ID: 1602091

    Description: epitope description:NFVRSSNLKFQDAYNAAGGH antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Homo sapiens

    Publication: 19005024;

  78. Peptide-based antibody detection for tuberculosis diagnosis.

    ID: 1602092

    Description: epitope description:NFVRSSNLKFQDAYNAAGGH antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Homo sapiens

    Publication: 19005024;

  79. Peptide-based antibody detection for tuberculosis diagnosis.

    ID: 1602095

    Description: epitope description:NAVFNFPPNGTHSWEYWGAQ antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Homo sapiens

    Publication: 19005024;

  80. Peptide-based antibody detection for tuberculosis diagnosis.

    ID: 1602099

    Description: epitope description:LNAMKGDLQSSLGAG antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85B host organism:Homo sapiens

    Publication: 19005024;

  81. The N-terminal domain of Plasmodium falciparum circumsporozoite protein represents a target of protective immunity.

    ID: 1602525

    Description: epitope description:YNRNTVNRLLADAPEGKKNEKKNEKIERNNKLK antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus C57BL/6 X BALB/c

    Publication: 18984024;

  82. The N-terminal domain of Plasmodium falciparum circumsporozoite protein represents a target of protective immunity.

    ID: 1602532

    Description: epitope description:LKKNSRSLGENDDGNNEDNEKLRKPKHKKLKQPADGNPDPNANPNV antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens

    Publication: 18984024;

  83. The N-terminal domain of Plasmodium falciparum circumsporozoite protein represents a target of protective immunity.

    ID: 1602533

    Description: epitope description:LKKNSRSLGENDDGNNEDNEKLRKPKHKKLKQPADGNPDPNANPNV antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens

    Publication: 18984024;

  84. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602780

    Description: epitope description:CLTGVAIAEQ antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  85. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602785

    Description: epitope description:AIAEQCGRQA antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  86. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602787

    Description: epitope description:AEQCGRQAGG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  87. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602789

    Description: epitope description:QCGRQAGGKL antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  88. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602792

    Description: epitope description:RQAGGKLCPN antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  89. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602793

    Description: epitope description:QAGGKLCPNN antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  90. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602802

    Description: epitope description:NLCCSQWGWC antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  91. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602818

    Description: epitope description:CSPDHNCQSN antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  92. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602819

    Description: epitope description:SPDHNCQSNC antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  93. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602820

    Description: epitope description:PDHNCQSNCK antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  94. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602821

    Description: epitope description:DHNCQSNCKD antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  95. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602823

    Description: epitope description:NCQSNCKDSG antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  96. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602833

    Description: epitope description:EGVGGGSASN antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  97. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602836

    Description: epitope description:GGGSASNVLA antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  98. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602841

    Description: epitope description:SNVLATYHLY antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  99. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602843

    Description: epitope description:VLATYHLYNS antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;

  100. IgE from latex-allergic patients binds to cloned and expressed B cell epitopes of prohevein.

    ID: 1602845

    Description: epitope description:ATYHLYNSQD antigen name:Hev b 6 host organism:Homo sapiens

    Publication: 9548517;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston