Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Epitope mapping and use of epitope-specific antisera to characterize the VP5* binding site in rotavirus SA11 NSP4.

    ID: 1479082

    Description: epitope description:DKLTTREIEQVE antigen name:Non-structural glycoprotein 4 host organism:Oryctolagus cuniculus

    Publication: 18164740;

  2. Epitope mapping of the major inner capsid protein of group A rotavirus using peptide synthesis.

    ID: 1479137

    Description: epitope description:SFP antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-50

    Publication: 7683153;

  3. Epitope mapping of the major inner capsid protein of group A rotavirus using peptide synthesis.

    ID: 1479142

    Description: epitope description:ERFSFPR antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-133

    Publication: 7683153;

  4. Epitope mapping of the major inner capsid protein of group A rotavirus using peptide synthesis.

    ID: 1479144

    Description: epitope description:SASFT antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-138

    Publication: 7683153;

  5. Epitope mapping of the major inner capsid protein of group A rotavirus using peptide synthesis.

    ID: 1479146

    Description: epitope description:QIINTY antigen name:Intermediate capsid protein VP6 host organism:Mus musculus antibody name:RV-138

    Publication: 7683153;

  6. Immunogenicity of peptides of measles virus origin and influence of adjuvants.

    ID: 1479152

    Description: epitope description:KPNLSSKRSELSQLS antigen name:Hemagglutinin glycoprotein host organism:Mus musculus BALB/c

    Publication: 16122851;

  7. Epitope mapping and use of epitope-specific antisera to characterize the VP5* binding site in rotavirus SA11 NSP4.

    ID: 1479153

    Description: epitope description:TLEEWESGKNPYEPRE antigen name:Non-structural glycoprotein 4 host organism:Oryctolagus cuniculus

    Publication: 18164740;

  8. Epitope mapping and use of epitope-specific antisera to characterize the VP5* binding site in rotavirus SA11 NSP4.

    ID: 1479154

    Description: epitope description:TLEEWESGKNPYEPRE antigen name:Non-structural glycoprotein 4 host organism:Oryctolagus cuniculus

    Publication: 18164740;

  9. Epitope mapping porcine reproductive and respiratory syndrome virus by phage display: the nsp2 fragment of the replicase polyprotein contains a cluste...

    ID: 1479224

    Description: epitope description:HHPVDLADWELIESPED antigen name:Replicase polyprotein 1ab host organism:Sus scrofa antibody name:42-dpi

    Publication: 11238854;

  10. Epitope mapping porcine reproductive and respiratory syndrome virus by phage display: the nsp2 fragment of the replicase polyprotein contains a cluste...

    ID: 1479227

    Description: epitope description:QERGHKAPHPAVLAGGLSKQQVQVVEGGRSGL antigen name:Replicase polyprotein 1ab host organism:Sus scrofa antibody name:42-dpi

    Publication: 11238854;

  11. Epitope mapping porcine reproductive and respiratory syndrome virus by phage display: the nsp2 fragment of the replicase polyprotein contains a cluste...

    ID: 1479231

    Description: epitope description:QPLNLSLAAWP antigen name:Replicase polyprotein 1ab host organism:Sus scrofa antibody name:42-dpi

    Publication: 11238854;

  12. Synthetic peptides induce antibody against a host-protective antigen of Echinococcus granulosus.

    ID: 1479255

    Description: epitope description:TETPLRKHFNLTPV antigen name:Antigen protein host organism:Ovis aries antibody name:sheep serum

    Publication: 10580190;

  13. Effect of adjuvant composition on immune response to a multiple antigen peptide (MAP) containing a protective epitope from Neisseria meningitidis clas...

    ID: 1479326

    Description: epitope description:TKNTNNNLTL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:mouse serum

    Publication: 10501243;

  14. Posttranslational processing and identification of a neutralization domain of the GP4 protein encoded by ORF4 of Lelystad virus.

    ID: 1479342

    Description: epitope description:AAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGT antigen name:Glycoprotein 4 host organism:Mus musculus antibody name:121.4, 122.1, 122.20...

    Publication: 9223499;

  15. Posttranslational processing and identification of a neutralization domain of the GP4 protein encoded by ORF4 of Lelystad virus.

    ID: 1479346

    Description: epitope description:AAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGT antigen name:Glycoprotein 4 host organism:Mus musculus antibody name:122.1, 122.20, 122.5...

    Publication: 9223499;

  16. Posttranslational processing and identification of a neutralization domain of the GP4 protein encoded by ORF4 of Lelystad virus.

    ID: 1479349

    Description: epitope description:QEKISFGKSSQCREAV antigen name:Glycoprotein 4 host organism:Oryctolagus cuniculus antibody name:serum 698

    Publication: 9223499;

  17. Identification of critical residues of an immunodominant region of Echinococcus granulosus antigen B.

    ID: 1479363

    Description: epitope description:KMFGEVKYFFERDPLGQKVVDLLKEL antigen name:AntigenB host organism:Homo sapiens

    Publication: 12660242;

  18. Synthetic peptides induce antibody against a host-protective antigen of Echinococcus granulosus.

    ID: 1479368

    Description: epitope description:SLKAVNPSDPLVYKRQTAKF antigen name:Antigen protein host organism:Ovis aries antibody name:affinity purified sheep serum

    Publication: 10580190;

  19. Neutralizing antibody to Mengo virus, induced by synthetic peptides.

    ID: 1479373

    Description: epitope description:PTSGDKIDMTPRAGVLMLE antigen name:Cardiovirus A protein host organism:Mus musculus BALB/cByJ antibody name:anti-F164

    Publication: 1709682;

  20. Neutralizing antibody to Mengo virus, induced by synthetic peptides.

    ID: 1479374

    Description: epitope description:PTSGDKIDMTPRAGVLMLE antigen name:Cardiovirus A protein host organism:Mus musculus BALB/cByJ antibody name:anti-F164

    Publication: 1709682;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston